Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y747

Protein Details
Accession G2Y747    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
84-109LKARGKGAPKKKRTAEDSKKFKGKKRBasic
NLS Segment(s)
PositionSequence
85-109KARGKGAPKKKRTAEDSKKFKGKKR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVAKSRVLELMKVQCRIFSTTFNPDRLRTGNKILRQRLKGPALAAYYPRKMATIKDLQKAYDEYDVETYDDAEEDRFEHITILKARGKGAPKKKRTAEDSKKFKGKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.36
4 0.39
5 0.34
6 0.29
7 0.29
8 0.36
9 0.4
10 0.43
11 0.43
12 0.39
13 0.42
14 0.41
15 0.41
16 0.35
17 0.4
18 0.42
19 0.46
20 0.54
21 0.58
22 0.62
23 0.61
24 0.61
25 0.6
26 0.56
27 0.51
28 0.43
29 0.39
30 0.33
31 0.29
32 0.28
33 0.24
34 0.22
35 0.21
36 0.2
37 0.17
38 0.16
39 0.16
40 0.18
41 0.24
42 0.27
43 0.32
44 0.32
45 0.31
46 0.33
47 0.33
48 0.28
49 0.23
50 0.18
51 0.14
52 0.15
53 0.15
54 0.14
55 0.13
56 0.11
57 0.07
58 0.07
59 0.07
60 0.05
61 0.05
62 0.06
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.13
69 0.16
70 0.2
71 0.23
72 0.24
73 0.25
74 0.3
75 0.37
76 0.41
77 0.5
78 0.55
79 0.6
80 0.69
81 0.75
82 0.78
83 0.79
84 0.81
85 0.81
86 0.81
87 0.83
88 0.83
89 0.85