G2Y747

UniProt ID: G2Y747   Organism: Botryotinia fuckeliana (strain T4)
Gene: BofuT4_P108330.1   Protein: Similar to similar to Mitochondrial ribosomal protein of the small subunit
Length: 134 AA

Protein Details

• Accession: G2Y747
• Localization Confidence: Medium
• Confidence Score: 13.6
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  84-109	LKARGKGAPKKKRTAEDSKKFKGKKR	Basic

• NLS Segment(s):

  Position	Sequence
  85-109	KARGKGAPKKKRTAEDSKKFKGKKR

• Subcellular Location(s): nucl 20.5, cyto_nucl 12, mito 4
• Family & Domain DBs:
  • InterPro:
    • IPR013219 Ribosomal_S27/S33_mit
  • Gene Ontology:
    • GO:0005739 C:mitochondrion
    • GO:1990904 C:ribonucleoprotein complex
    • GO:0005840 C:ribosome
  • Pfam:
    • PF08293 MRP-S33
• Amino Acid Sequences: MSVAKSRVLELMKVQCRIFSTTFNPDRLRTGNKILRQRLKGPALAAYYPRKMATIKDLQKAYDEYDVETYDDAEEDRFEHITILKARGKGAPKKKRTAEDSKKFKGKKR

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.39
2, 0.35
3, 0.36
4, 0.39
5, 0.34
6, 0.29
7, 0.29
8, 0.36
9, 0.4
10, 0.43
11, 0.43
12, 0.39
13, 0.42
14, 0.41
15, 0.41
16, 0.35
17, 0.4
18, 0.42
19, 0.46
20, 0.54
21, 0.58
22, 0.62
23, 0.61
24, 0.61
25, 0.6
26, 0.56
27, 0.51
28, 0.43
29, 0.39
30, 0.33
31, 0.29
32, 0.28
33, 0.24
34, 0.22
35, 0.21
36, 0.2
37, 0.17
38, 0.16
39, 0.16
40, 0.18
41, 0.24
42, 0.27
43, 0.32
44, 0.32
45, 0.31
46, 0.33
47, 0.33
48, 0.28
49, 0.23
50, 0.18
51, 0.14
52, 0.15
53, 0.15
54, 0.14
55, 0.13
56, 0.11
57, 0.07
58, 0.07
59, 0.07
60, 0.05
61, 0.05
62, 0.06
63, 0.07
64, 0.07
65, 0.07
66, 0.08
67, 0.08
68, 0.13
69, 0.16
70, 0.2
71, 0.23
72, 0.24
73, 0.25
74, 0.3
75, 0.37
76, 0.41
77, 0.5
78, 0.55
79, 0.6
80, 0.69
81, 0.75
82, 0.78
83, 0.79
84, 0.81
85, 0.81
86, 0.81
87, 0.83
88, 0.83
89, 0.85