Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YVL3

Protein Details
Accession G2YVL3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
3-22TNPRSPSPKMWSPRNPPPQSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 12, nucl 7.5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011008  Dimeric_a/b-barrel  
IPR008000  Rham/fucose_mutarotase  
Gene Ontology GO:0016857  F:racemase and epimerase activity, acting on carbohydrates and derivatives  
Pfam View protein in Pfam  
PF05336  rhaM  
Amino Acid Sequences MWTNPRSPSPKMWSPRNPPPQSSHRSSHSQSHPFSPLSPLTPSGPSGTFPAPTQKLKNQGKRIAQIVKIKPECVELYKECHARVWPEVLKQIKECYMEDYSIHYDPQHNLLFASFKYVGYDYAGDMEKMRENPKVREWWAMTDSYQESLVEGSTGSTDERGWWKGVEEVFYVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.8
3 0.82
4 0.79
5 0.74
6 0.73
7 0.73
8 0.71
9 0.68
10 0.63
11 0.57
12 0.6
13 0.59
14 0.61
15 0.6
16 0.6
17 0.56
18 0.55
19 0.54
20 0.47
21 0.45
22 0.4
23 0.32
24 0.27
25 0.26
26 0.23
27 0.21
28 0.22
29 0.22
30 0.2
31 0.18
32 0.17
33 0.18
34 0.17
35 0.16
36 0.15
37 0.22
38 0.23
39 0.26
40 0.3
41 0.31
42 0.41
43 0.49
44 0.57
45 0.58
46 0.62
47 0.64
48 0.63
49 0.64
50 0.59
51 0.55
52 0.55
53 0.5
54 0.52
55 0.47
56 0.44
57 0.39
58 0.36
59 0.32
60 0.25
61 0.26
62 0.17
63 0.21
64 0.26
65 0.27
66 0.24
67 0.25
68 0.23
69 0.21
70 0.21
71 0.21
72 0.18
73 0.18
74 0.23
75 0.24
76 0.25
77 0.23
78 0.24
79 0.21
80 0.21
81 0.2
82 0.19
83 0.18
84 0.17
85 0.17
86 0.19
87 0.19
88 0.17
89 0.17
90 0.14
91 0.15
92 0.15
93 0.2
94 0.18
95 0.14
96 0.14
97 0.14
98 0.15
99 0.13
100 0.18
101 0.13
102 0.12
103 0.13
104 0.14
105 0.14
106 0.14
107 0.15
108 0.09
109 0.11
110 0.12
111 0.11
112 0.11
113 0.12
114 0.14
115 0.16
116 0.18
117 0.22
118 0.26
119 0.3
120 0.36
121 0.42
122 0.41
123 0.46
124 0.46
125 0.45
126 0.44
127 0.41
128 0.35
129 0.32
130 0.31
131 0.24
132 0.23
133 0.17
134 0.14
135 0.13
136 0.13
137 0.08
138 0.07
139 0.06
140 0.06
141 0.06
142 0.07
143 0.07
144 0.07
145 0.11
146 0.16
147 0.18
148 0.19
149 0.19
150 0.2
151 0.24
152 0.26
153 0.25