Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XT32

Protein Details
Accession G2XT32    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
46-84KTDVSKPKKDDKCKSCEKKKKKEEKKKEKKKSAGGCIVSBasic
NLS Segment(s)
PositionSequence
62-77EKKKKKEEKKKEKKKS
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 7, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPADWRTDKSGNVKGFIRRKGDPNPLNWGYKVDDKVLSHPKAAMIKTDVSKPKKDDKCKSCEKKKKKEEKKKEKKKSAGGCIVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.53
4 0.52
5 0.47
6 0.51
7 0.55
8 0.61
9 0.57
10 0.52
11 0.55
12 0.53
13 0.52
14 0.46
15 0.4
16 0.32
17 0.33
18 0.31
19 0.24
20 0.23
21 0.22
22 0.28
23 0.34
24 0.32
25 0.27
26 0.26
27 0.26
28 0.27
29 0.26
30 0.21
31 0.15
32 0.17
33 0.18
34 0.24
35 0.29
36 0.29
37 0.33
38 0.36
39 0.44
40 0.51
41 0.59
42 0.63
43 0.63
44 0.68
45 0.75
46 0.82
47 0.83
48 0.85
49 0.86
50 0.87
51 0.91
52 0.93
53 0.94
54 0.95
55 0.95
56 0.96
57 0.97
58 0.97
59 0.97
60 0.97
61 0.95
62 0.94
63 0.92
64 0.91