Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YYF3

Protein Details
Accession G2YYF3    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-21SGRAERPSKRIRKLSTDSEGHydrophilic
339-360ETINKLLKKQAPKTNARRRDLNHydrophilic
NLS Segment(s)
PositionSequence
322-332ARRRKNLSEKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029523  INO80B/Ies2  
IPR006880  INO80B_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04795  PAPA-1  
Amino Acid Sequences MSGRAERPSKRIRKLSTDSEGDEEIDWTDHRGKVDRAEPATNKNESSRSRRTNPEPASSATVSRGPAQPQSNSPESMRLTVKTSSSKLREATRSSPITGPAVMVNSRDQFVGGEILEGKRNRNVKKSYVLETESDDEDEDMEDAEGEDDPDAEGEDDDLDADGDIDMDVQHTSSTIQVSKAPAGTSNITVKEQPKAPAVTIGHQGLGLSDDDDDELSELDSDLGEELEEEEVMQSGNDEDAEGEDEEIEVAAEEEDELLDSDDETPANESRASTPDLNKLTRRQRARFDDAASGYLMALPDEVQVKKHLTAEEHAMRRAEMARRRKNLSEKRNEEEKMETINKLLKKQAPKTNARRRDLNGPTVDAIPEGEPQKPNPLFVRWVSNKDGNRIGVPEEWMEGPIGALFQGGAKASGNGMDGKLIQEVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.78
4 0.73
5 0.66
6 0.6
7 0.54
8 0.45
9 0.37
10 0.28
11 0.21
12 0.17
13 0.14
14 0.14
15 0.18
16 0.19
17 0.21
18 0.25
19 0.27
20 0.32
21 0.38
22 0.42
23 0.42
24 0.47
25 0.49
26 0.52
27 0.56
28 0.51
29 0.48
30 0.44
31 0.47
32 0.46
33 0.51
34 0.54
35 0.56
36 0.61
37 0.68
38 0.72
39 0.75
40 0.74
41 0.73
42 0.66
43 0.61
44 0.6
45 0.52
46 0.46
47 0.38
48 0.35
49 0.28
50 0.28
51 0.28
52 0.24
53 0.3
54 0.33
55 0.33
56 0.35
57 0.4
58 0.4
59 0.39
60 0.37
61 0.37
62 0.34
63 0.36
64 0.33
65 0.28
66 0.28
67 0.28
68 0.31
69 0.3
70 0.32
71 0.36
72 0.37
73 0.4
74 0.41
75 0.45
76 0.48
77 0.49
78 0.51
79 0.51
80 0.49
81 0.47
82 0.45
83 0.4
84 0.35
85 0.29
86 0.25
87 0.18
88 0.18
89 0.15
90 0.15
91 0.16
92 0.15
93 0.16
94 0.15
95 0.14
96 0.12
97 0.12
98 0.12
99 0.09
100 0.09
101 0.1
102 0.11
103 0.16
104 0.16
105 0.17
106 0.21
107 0.28
108 0.31
109 0.39
110 0.43
111 0.43
112 0.51
113 0.54
114 0.54
115 0.52
116 0.51
117 0.43
118 0.41
119 0.38
120 0.3
121 0.26
122 0.2
123 0.14
124 0.12
125 0.11
126 0.08
127 0.06
128 0.05
129 0.04
130 0.04
131 0.05
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.03
148 0.04
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.05
161 0.07
162 0.07
163 0.08
164 0.1
165 0.12
166 0.13
167 0.13
168 0.12
169 0.12
170 0.14
171 0.14
172 0.14
173 0.16
174 0.16
175 0.16
176 0.19
177 0.19
178 0.19
179 0.21
180 0.21
181 0.21
182 0.21
183 0.2
184 0.23
185 0.22
186 0.21
187 0.22
188 0.2
189 0.17
190 0.16
191 0.15
192 0.1
193 0.1
194 0.08
195 0.05
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.05
229 0.05
230 0.05
231 0.05
232 0.05
233 0.05
234 0.05
235 0.04
236 0.02
237 0.03
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.03
244 0.03
245 0.03
246 0.03
247 0.04
248 0.04
249 0.05
250 0.05
251 0.05
252 0.07
253 0.07
254 0.08
255 0.08
256 0.09
257 0.1
258 0.13
259 0.16
260 0.17
261 0.19
262 0.25
263 0.29
264 0.31
265 0.33
266 0.39
267 0.45
268 0.5
269 0.56
270 0.54
271 0.6
272 0.65
273 0.69
274 0.65
275 0.59
276 0.57
277 0.5
278 0.46
279 0.36
280 0.28
281 0.2
282 0.17
283 0.13
284 0.07
285 0.06
286 0.05
287 0.06
288 0.09
289 0.1
290 0.1
291 0.13
292 0.15
293 0.17
294 0.2
295 0.2
296 0.19
297 0.21
298 0.28
299 0.34
300 0.34
301 0.34
302 0.32
303 0.3
304 0.29
305 0.32
306 0.31
307 0.32
308 0.4
309 0.48
310 0.53
311 0.59
312 0.64
313 0.7
314 0.73
315 0.75
316 0.76
317 0.73
318 0.74
319 0.77
320 0.72
321 0.63
322 0.57
323 0.49
324 0.45
325 0.41
326 0.35
327 0.28
328 0.33
329 0.34
330 0.33
331 0.37
332 0.36
333 0.42
334 0.51
335 0.57
336 0.6
337 0.68
338 0.76
339 0.8
340 0.84
341 0.8
342 0.79
343 0.74
344 0.75
345 0.71
346 0.69
347 0.61
348 0.54
349 0.5
350 0.44
351 0.4
352 0.29
353 0.24
354 0.16
355 0.18
356 0.16
357 0.19
358 0.2
359 0.21
360 0.31
361 0.3
362 0.33
363 0.32
364 0.35
365 0.35
366 0.36
367 0.45
368 0.4
369 0.45
370 0.48
371 0.52
372 0.51
373 0.52
374 0.55
375 0.46
376 0.43
377 0.4
378 0.36
379 0.31
380 0.3
381 0.25
382 0.22
383 0.2
384 0.18
385 0.17
386 0.14
387 0.12
388 0.09
389 0.08
390 0.06
391 0.06
392 0.05
393 0.05
394 0.07
395 0.07
396 0.08
397 0.08
398 0.09
399 0.09
400 0.11
401 0.12
402 0.12
403 0.12
404 0.13
405 0.13
406 0.14