Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YKS8

Protein Details
Accession G2YKS8    Localization Confidence High Confidence Score 20.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-44EDEDGKEKGKRREEKRRERKERRHIYIYRLTBasic
172-195ATAPKKPATTTKKPVSKKPAVKAAHydrophilic
NLS Segment(s)
PositionSequence
19-38KEKGKRREEKRRERKERRHI
86-125APKPKKAAKANTGKKVAPTNGVKPTKGSKPTGVQKNAPKK
165-195KPAPKAKATAPKKPATTTKKPVSKKPAVKAA
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MRDMLRENRNEPNEDEDGKEKGKRREEKRRERKERRHIYIYRLTRRKPLHNPSNPFHSNKETMPSVTRSSSGKIPVKQPVSPPVDAPKPKKAAKANTGKKVAPTNGVKPTKGSKPTGVQKNAPKKESTVAAKVKAAVEKTEKVAEEAAETAEEKVEETTAATAEKPAPKAKATAPKKPATTTKKPVSKKPAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.34
4 0.34
5 0.34
6 0.37
7 0.38
8 0.42
9 0.5
10 0.57
11 0.64
12 0.71
13 0.79
14 0.85
15 0.89
16 0.92
17 0.94
18 0.95
19 0.96
20 0.96
21 0.96
22 0.93
23 0.91
24 0.84
25 0.81
26 0.79
27 0.78
28 0.77
29 0.74
30 0.68
31 0.67
32 0.68
33 0.69
34 0.7
35 0.71
36 0.71
37 0.73
38 0.77
39 0.72
40 0.75
41 0.7
42 0.63
43 0.56
44 0.5
45 0.44
46 0.37
47 0.39
48 0.3
49 0.28
50 0.28
51 0.27
52 0.25
53 0.23
54 0.23
55 0.2
56 0.21
57 0.22
58 0.27
59 0.29
60 0.3
61 0.33
62 0.38
63 0.4
64 0.4
65 0.39
66 0.4
67 0.39
68 0.36
69 0.33
70 0.31
71 0.35
72 0.38
73 0.4
74 0.39
75 0.4
76 0.42
77 0.47
78 0.49
79 0.49
80 0.52
81 0.59
82 0.6
83 0.61
84 0.63
85 0.56
86 0.53
87 0.49
88 0.41
89 0.37
90 0.32
91 0.3
92 0.35
93 0.37
94 0.35
95 0.33
96 0.36
97 0.36
98 0.38
99 0.35
100 0.3
101 0.36
102 0.45
103 0.51
104 0.51
105 0.5
106 0.55
107 0.63
108 0.65
109 0.59
110 0.51
111 0.44
112 0.43
113 0.43
114 0.39
115 0.36
116 0.34
117 0.35
118 0.35
119 0.34
120 0.33
121 0.3
122 0.26
123 0.22
124 0.22
125 0.22
126 0.24
127 0.25
128 0.23
129 0.22
130 0.22
131 0.19
132 0.15
133 0.14
134 0.12
135 0.09
136 0.1
137 0.09
138 0.08
139 0.08
140 0.07
141 0.07
142 0.07
143 0.06
144 0.06
145 0.07
146 0.07
147 0.08
148 0.07
149 0.09
150 0.13
151 0.18
152 0.2
153 0.24
154 0.26
155 0.27
156 0.3
157 0.36
158 0.42
159 0.45
160 0.52
161 0.55
162 0.59
163 0.61
164 0.64
165 0.67
166 0.65
167 0.69
168 0.69
169 0.71
170 0.74
171 0.76
172 0.81
173 0.81
174 0.82
175 0.81