Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YF73

Protein Details
Accession G2YF73    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
37-65SFRSASRLGRDQKKKKKKKTPSLTYSTISHydrophilic
NLS Segment(s)
PositionSequence
44-55LGRDQKKKKKKK
Subcellular Location(s) mito 17.5, mito_nucl 13.666, nucl 8.5, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MSRENIPGIPLRALSLKILKRSNSSVVGSTLTPPSFSFRSASRLGRDQKKKKKKKTPSLTYSTISHTAPENPHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.25
4 0.3
5 0.34
6 0.35
7 0.37
8 0.4
9 0.41
10 0.37
11 0.35
12 0.3
13 0.27
14 0.26
15 0.22
16 0.2
17 0.18
18 0.14
19 0.13
20 0.12
21 0.14
22 0.13
23 0.14
24 0.14
25 0.12
26 0.17
27 0.2
28 0.23
29 0.22
30 0.28
31 0.35
32 0.44
33 0.53
34 0.59
35 0.67
36 0.76
37 0.84
38 0.87
39 0.91
40 0.92
41 0.93
42 0.94
43 0.94
44 0.92
45 0.89
46 0.83
47 0.76
48 0.67
49 0.61
50 0.53
51 0.42
52 0.34
53 0.28
54 0.28