Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y731

Protein Details
Accession G2Y731   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-56STHPHRPPANPPKDKKKKKLGNHTILMBasic
NLS Segment(s)
PositionSequence
34-48HRPPANPPKDKKKKK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MRTKEVIKHRIRTEEVINSSAQDKTRQVPSTHPHRPPANPPKDKKKKKLGNHTILMNIDISHLQNPIRHRNSQFHSFPSLPPPAQRSAHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.52
3 0.45
4 0.4
5 0.33
6 0.31
7 0.29
8 0.24
9 0.19
10 0.18
11 0.2
12 0.27
13 0.3
14 0.29
15 0.34
16 0.4
17 0.46
18 0.53
19 0.53
20 0.52
21 0.52
22 0.54
23 0.57
24 0.61
25 0.62
26 0.62
27 0.64
28 0.69
29 0.76
30 0.82
31 0.8
32 0.8
33 0.79
34 0.8
35 0.86
36 0.85
37 0.82
38 0.77
39 0.7
40 0.62
41 0.53
42 0.45
43 0.33
44 0.22
45 0.15
46 0.11
47 0.1
48 0.08
49 0.09
50 0.1
51 0.12
52 0.17
53 0.27
54 0.31
55 0.36
56 0.39
57 0.46
58 0.52
59 0.58
60 0.56
61 0.49
62 0.52
63 0.48
64 0.46
65 0.44
66 0.44
67 0.36
68 0.38
69 0.38
70 0.38