Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y2E1

Protein Details
Accession G2Y2E1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
151-183GFGPHKHKKPYVESKGRKFEKARGRRRSRGFKVBasic
NLS Segment(s)
PositionSequence
148-183KHFGFGPHKHKKPYVESKGRKFEKARGRRRSRGFKV
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR021132  Ribosomal_L18/L18-A/B/e_CS  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
PROSITE View protein in PROSITE  
PS01106  RIBOSOMAL_L18E  
Amino Acid Sequences MGIDLDNHHVRNTHRKTPKSDNVYLKLLVKLYRFLARRTEASFNKVVLRRLFMSRINRPPVSISRIASQTNKEEKRTVVIIGTVTDDNRLLSVPKVSVAALRFTATARARILAAGGEALTLDQLALRSPTGSNTVLLRGPKNSREAVKHFGFGPHKHKKPYVESKGRKFEKARGRRRSRGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.66
4 0.73
5 0.79
6 0.76
7 0.78
8 0.76
9 0.72
10 0.7
11 0.64
12 0.56
13 0.48
14 0.42
15 0.36
16 0.29
17 0.26
18 0.25
19 0.3
20 0.29
21 0.29
22 0.34
23 0.34
24 0.36
25 0.38
26 0.43
27 0.38
28 0.42
29 0.42
30 0.36
31 0.39
32 0.39
33 0.39
34 0.32
35 0.34
36 0.32
37 0.32
38 0.35
39 0.34
40 0.38
41 0.42
42 0.48
43 0.51
44 0.48
45 0.46
46 0.47
47 0.45
48 0.43
49 0.38
50 0.31
51 0.28
52 0.31
53 0.32
54 0.3
55 0.29
56 0.3
57 0.36
58 0.37
59 0.36
60 0.35
61 0.33
62 0.34
63 0.33
64 0.26
65 0.17
66 0.15
67 0.13
68 0.11
69 0.13
70 0.1
71 0.08
72 0.08
73 0.08
74 0.07
75 0.07
76 0.06
77 0.05
78 0.05
79 0.06
80 0.06
81 0.06
82 0.07
83 0.07
84 0.09
85 0.09
86 0.1
87 0.1
88 0.1
89 0.1
90 0.09
91 0.16
92 0.14
93 0.16
94 0.15
95 0.15
96 0.14
97 0.14
98 0.14
99 0.08
100 0.07
101 0.05
102 0.04
103 0.04
104 0.03
105 0.03
106 0.03
107 0.03
108 0.02
109 0.03
110 0.03
111 0.04
112 0.04
113 0.05
114 0.06
115 0.06
116 0.08
117 0.11
118 0.12
119 0.13
120 0.13
121 0.15
122 0.17
123 0.19
124 0.19
125 0.21
126 0.25
127 0.27
128 0.31
129 0.33
130 0.35
131 0.4
132 0.43
133 0.45
134 0.43
135 0.41
136 0.38
137 0.41
138 0.42
139 0.42
140 0.46
141 0.5
142 0.54
143 0.58
144 0.62
145 0.62
146 0.67
147 0.72
148 0.73
149 0.73
150 0.77
151 0.81
152 0.87
153 0.84
154 0.81
155 0.74
156 0.72
157 0.72
158 0.73
159 0.74
160 0.75
161 0.8
162 0.82
163 0.89