Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YWX9

Protein Details
Accession G2YWX9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
137-156KASIRDRRSRVMRLRREDVRBasic
NLS Segment(s)
PositionSequence
141-149RDRRSRVMR
Subcellular Location(s) mito 13.5, mito_nucl 11.5, nucl 8.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MTLRGQRAKLGIDDLGSVTSLVIGKLARQFFAKICFVGSVSSHCAFTSFHFTSFAKSRAANRSNIVSKIRGSPVLQLRISKSNMNMTLDPRFPSGKYEQYDDKPRHNFSHEVWDYTKAESRKPMGEHPTKFMGRNIKASIRDRRSRVMRLRREDVREVQKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.13
4 0.12
5 0.08
6 0.08
7 0.08
8 0.07
9 0.07
10 0.07
11 0.09
12 0.15
13 0.16
14 0.16
15 0.17
16 0.19
17 0.2
18 0.25
19 0.25
20 0.19
21 0.19
22 0.19
23 0.18
24 0.17
25 0.16
26 0.14
27 0.17
28 0.17
29 0.17
30 0.16
31 0.16
32 0.15
33 0.17
34 0.22
35 0.18
36 0.18
37 0.21
38 0.21
39 0.25
40 0.28
41 0.28
42 0.21
43 0.22
44 0.27
45 0.33
46 0.36
47 0.34
48 0.32
49 0.37
50 0.37
51 0.39
52 0.35
53 0.27
54 0.26
55 0.27
56 0.26
57 0.22
58 0.2
59 0.23
60 0.26
61 0.3
62 0.29
63 0.27
64 0.28
65 0.3
66 0.31
67 0.26
68 0.22
69 0.21
70 0.22
71 0.24
72 0.22
73 0.2
74 0.22
75 0.22
76 0.22
77 0.19
78 0.18
79 0.16
80 0.19
81 0.2
82 0.23
83 0.23
84 0.26
85 0.29
86 0.33
87 0.42
88 0.41
89 0.46
90 0.45
91 0.47
92 0.46
93 0.45
94 0.43
95 0.35
96 0.44
97 0.37
98 0.35
99 0.33
100 0.34
101 0.31
102 0.31
103 0.34
104 0.24
105 0.26
106 0.27
107 0.29
108 0.3
109 0.32
110 0.37
111 0.41
112 0.49
113 0.49
114 0.48
115 0.53
116 0.49
117 0.48
118 0.46
119 0.46
120 0.41
121 0.45
122 0.45
123 0.43
124 0.48
125 0.54
126 0.59
127 0.59
128 0.64
129 0.62
130 0.67
131 0.68
132 0.7
133 0.74
134 0.74
135 0.75
136 0.76
137 0.8
138 0.79
139 0.79
140 0.76
141 0.75
142 0.75