Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XZ84

Protein Details
Accession G2XZ84    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
79-100GEKGRDKERKQREQDQQRRAGGBasic
NLS Segment(s)
PositionSequence
50-104RRRGEERRGEERRAETRREERRQREERRQGEKGRDKERKQREQDQQRRAGGIHKK
Subcellular Location(s) nucl 11, cysk 7, mito 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MAVVLHAIMEIRDWTRAPPRAELLTNSANKVSSGFIPYSYCSRQAIEEERRRGEERRGEERRAETRREERRQREERRQGEKGRDKERKQREQDQQRRAGGIHKKASRCPVMAEGNLGHTPYAHLPGANWINGKEGMGLCLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.23
3 0.3
4 0.32
5 0.34
6 0.38
7 0.4
8 0.42
9 0.4
10 0.38
11 0.39
12 0.38
13 0.35
14 0.31
15 0.27
16 0.25
17 0.24
18 0.19
19 0.13
20 0.14
21 0.13
22 0.13
23 0.14
24 0.16
25 0.2
26 0.2
27 0.2
28 0.19
29 0.19
30 0.19
31 0.22
32 0.29
33 0.34
34 0.4
35 0.43
36 0.44
37 0.47
38 0.48
39 0.46
40 0.45
41 0.42
42 0.4
43 0.46
44 0.49
45 0.47
46 0.48
47 0.51
48 0.53
49 0.49
50 0.46
51 0.41
52 0.45
53 0.53
54 0.58
55 0.62
56 0.61
57 0.68
58 0.75
59 0.77
60 0.79
61 0.79
62 0.79
63 0.78
64 0.77
65 0.72
66 0.72
67 0.72
68 0.69
69 0.69
70 0.7
71 0.67
72 0.7
73 0.76
74 0.76
75 0.74
76 0.77
77 0.77
78 0.8
79 0.84
80 0.84
81 0.81
82 0.72
83 0.66
84 0.57
85 0.54
86 0.51
87 0.49
88 0.48
89 0.46
90 0.48
91 0.5
92 0.57
93 0.53
94 0.46
95 0.41
96 0.4
97 0.39
98 0.36
99 0.35
100 0.28
101 0.28
102 0.28
103 0.25
104 0.18
105 0.13
106 0.15
107 0.13
108 0.17
109 0.13
110 0.13
111 0.13
112 0.21
113 0.25
114 0.25
115 0.24
116 0.21
117 0.24
118 0.24
119 0.24
120 0.19
121 0.16