Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y7J4

Protein Details
Accession G2Y7J4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
179-207LEGAEKEGKKEKKKKERKGEEGRNLQLRPBasic
235-262GDRWTAWRKANARKTKNAEKRGLSSRKKHydrophilic
NLS Segment(s)
PositionSequence
184-200KEGKKEKKKKERKGEEG
222-263AERAKVKVRLYKPGDRWTAWRKANARKTKNAEKRGLSSRKKK
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
IPR018261  Ribosomal_L27_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
PROSITE View protein in PROSITE  
PS00831  RIBOSOMAL_L27  
Amino Acid Sequences MLLPRLQPPLRGAITCISRTSSASAAETHLCEALAHLSFRKSSSPLAPLIAVRHASHAAQGAVNKAKDGPGKRLGAKKSGEQYVIPGNIIFRQRGTHWFPGENCAMGRDHTIYATQPGFVKYYKDPERHPKRQYIGVVFKREQVLPLPRNTIRRRRLGMEVAKIEEPEVEQAVEVEVSLEGAEKEGKKEKKKKERKGEEGRNLQLRPGYMYREANWEIGRAAERAKVKVRLYKPGDRWTAWRKANARKTKNAEKRGLSSRKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.34
4 0.29
5 0.27
6 0.28
7 0.29
8 0.24
9 0.21
10 0.2
11 0.2
12 0.2
13 0.21
14 0.2
15 0.18
16 0.16
17 0.14
18 0.13
19 0.12
20 0.13
21 0.13
22 0.13
23 0.13
24 0.15
25 0.16
26 0.17
27 0.19
28 0.18
29 0.2
30 0.23
31 0.25
32 0.25
33 0.26
34 0.26
35 0.24
36 0.24
37 0.24
38 0.21
39 0.18
40 0.19
41 0.19
42 0.18
43 0.18
44 0.18
45 0.15
46 0.15
47 0.15
48 0.17
49 0.21
50 0.21
51 0.2
52 0.18
53 0.2
54 0.25
55 0.27
56 0.29
57 0.31
58 0.35
59 0.4
60 0.47
61 0.46
62 0.47
63 0.46
64 0.45
65 0.44
66 0.43
67 0.4
68 0.33
69 0.33
70 0.31
71 0.29
72 0.24
73 0.18
74 0.15
75 0.17
76 0.19
77 0.17
78 0.12
79 0.13
80 0.15
81 0.21
82 0.27
83 0.29
84 0.29
85 0.32
86 0.32
87 0.34
88 0.33
89 0.27
90 0.21
91 0.17
92 0.15
93 0.12
94 0.13
95 0.11
96 0.1
97 0.1
98 0.1
99 0.09
100 0.12
101 0.11
102 0.11
103 0.1
104 0.11
105 0.12
106 0.12
107 0.14
108 0.13
109 0.21
110 0.27
111 0.29
112 0.32
113 0.42
114 0.51
115 0.57
116 0.6
117 0.58
118 0.54
119 0.57
120 0.56
121 0.52
122 0.52
123 0.49
124 0.5
125 0.44
126 0.44
127 0.4
128 0.36
129 0.3
130 0.25
131 0.27
132 0.25
133 0.26
134 0.29
135 0.3
136 0.38
137 0.44
138 0.49
139 0.47
140 0.51
141 0.52
142 0.51
143 0.53
144 0.53
145 0.52
146 0.49
147 0.45
148 0.4
149 0.37
150 0.33
151 0.28
152 0.21
153 0.15
154 0.1
155 0.09
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.05
162 0.04
163 0.03
164 0.03
165 0.04
166 0.04
167 0.03
168 0.04
169 0.07
170 0.07
171 0.11
172 0.19
173 0.26
174 0.36
175 0.46
176 0.56
177 0.65
178 0.76
179 0.83
180 0.87
181 0.91
182 0.91
183 0.93
184 0.93
185 0.92
186 0.9
187 0.85
188 0.81
189 0.7
190 0.61
191 0.52
192 0.41
193 0.36
194 0.3
195 0.28
196 0.26
197 0.28
198 0.28
199 0.33
200 0.34
201 0.32
202 0.3
203 0.27
204 0.22
205 0.21
206 0.22
207 0.15
208 0.15
209 0.17
210 0.19
211 0.23
212 0.29
213 0.34
214 0.37
215 0.45
216 0.48
217 0.53
218 0.57
219 0.63
220 0.64
221 0.66
222 0.68
223 0.61
224 0.65
225 0.63
226 0.66
227 0.6
228 0.62
229 0.6
230 0.65
231 0.73
232 0.76
233 0.76
234 0.76
235 0.81
236 0.83
237 0.86
238 0.85
239 0.83
240 0.79
241 0.79
242 0.79
243 0.81