Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XVT1

Protein Details
Accession G2XVT1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
85-104RKLSRNSRLPPRRYSQKTRVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
Amino Acid Sequences MYVCTYVCMYNTLVTKTHIVPTNQPQPTRSPNYRVKVNPPPQRKNLGISADEENESISIDGVSRRLHKNERRTLIVEDEDAEGARKLSRNSRLPPRRYSQKTRVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.23
4 0.28
5 0.29
6 0.28
7 0.32
8 0.39
9 0.47
10 0.48
11 0.48
12 0.44
13 0.44
14 0.5
15 0.53
16 0.49
17 0.47
18 0.51
19 0.55
20 0.61
21 0.58
22 0.58
23 0.6
24 0.65
25 0.67
26 0.68
27 0.69
28 0.66
29 0.69
30 0.63
31 0.56
32 0.51
33 0.46
34 0.37
35 0.32
36 0.3
37 0.25
38 0.24
39 0.2
40 0.14
41 0.11
42 0.1
43 0.07
44 0.05
45 0.04
46 0.04
47 0.04
48 0.06
49 0.07
50 0.11
51 0.14
52 0.18
53 0.27
54 0.35
55 0.44
56 0.52
57 0.56
58 0.56
59 0.57
60 0.55
61 0.5
62 0.44
63 0.35
64 0.27
65 0.23
66 0.19
67 0.16
68 0.14
69 0.1
70 0.09
71 0.1
72 0.12
73 0.13
74 0.21
75 0.3
76 0.37
77 0.45
78 0.55
79 0.64
80 0.67
81 0.73
82 0.75
83 0.77
84 0.78
85 0.8
86 0.79