Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YT83

Protein Details
Accession G2YT83    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
219-241VTYTPRMSPAPKGKRRKVDHHVEHydrophilic
NLS Segment(s)
PositionSequence
230-235KGKRRK
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MESPIKASAPAAVSAPILPPPKRSMSTTKPKLPQLKTPMSSTFPSELSALSNSARSPLPGYADFIIKQEDSIKTPITPPLAYTDFLKTMNSPVVTEIKCSRPTPTSAPSSESLTSSEGSDCSCNCDAHKSPATSVPPTPFSYPTSAPSSAILGRLRIPASPASSYAESPLSARSPFSARSARSPYDWDLRGKARYFDIKPQKQTRSSVRQVREVVTRTVTYTPRMSPAPKGKRRKVDHHVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.21
5 0.21
6 0.24
7 0.28
8 0.34
9 0.36
10 0.4
11 0.43
12 0.48
13 0.58
14 0.64
15 0.68
16 0.68
17 0.74
18 0.79
19 0.74
20 0.73
21 0.72
22 0.72
23 0.66
24 0.64
25 0.59
26 0.54
27 0.51
28 0.45
29 0.38
30 0.29
31 0.27
32 0.23
33 0.19
34 0.17
35 0.17
36 0.14
37 0.12
38 0.13
39 0.11
40 0.13
41 0.13
42 0.12
43 0.13
44 0.13
45 0.17
46 0.16
47 0.19
48 0.18
49 0.2
50 0.2
51 0.18
52 0.19
53 0.15
54 0.14
55 0.15
56 0.16
57 0.16
58 0.18
59 0.18
60 0.17
61 0.18
62 0.21
63 0.2
64 0.18
65 0.16
66 0.19
67 0.2
68 0.2
69 0.2
70 0.2
71 0.18
72 0.19
73 0.19
74 0.14
75 0.14
76 0.16
77 0.15
78 0.12
79 0.13
80 0.18
81 0.18
82 0.2
83 0.21
84 0.22
85 0.25
86 0.26
87 0.27
88 0.23
89 0.26
90 0.28
91 0.3
92 0.3
93 0.28
94 0.3
95 0.29
96 0.3
97 0.27
98 0.23
99 0.19
100 0.16
101 0.15
102 0.12
103 0.12
104 0.08
105 0.08
106 0.09
107 0.07
108 0.11
109 0.12
110 0.12
111 0.12
112 0.17
113 0.18
114 0.23
115 0.28
116 0.24
117 0.24
118 0.29
119 0.31
120 0.28
121 0.28
122 0.25
123 0.23
124 0.24
125 0.25
126 0.22
127 0.21
128 0.23
129 0.22
130 0.23
131 0.25
132 0.23
133 0.22
134 0.2
135 0.2
136 0.17
137 0.2
138 0.17
139 0.13
140 0.14
141 0.16
142 0.16
143 0.14
144 0.15
145 0.14
146 0.16
147 0.16
148 0.16
149 0.17
150 0.18
151 0.18
152 0.18
153 0.16
154 0.14
155 0.13
156 0.14
157 0.12
158 0.12
159 0.12
160 0.12
161 0.14
162 0.16
163 0.2
164 0.24
165 0.24
166 0.31
167 0.37
168 0.37
169 0.36
170 0.39
171 0.38
172 0.4
173 0.41
174 0.36
175 0.35
176 0.38
177 0.42
178 0.39
179 0.37
180 0.34
181 0.4
182 0.4
183 0.45
184 0.52
185 0.55
186 0.63
187 0.69
188 0.72
189 0.69
190 0.73
191 0.73
192 0.72
193 0.73
194 0.73
195 0.68
196 0.69
197 0.66
198 0.63
199 0.61
200 0.54
201 0.48
202 0.43
203 0.39
204 0.33
205 0.36
206 0.34
207 0.31
208 0.31
209 0.3
210 0.3
211 0.34
212 0.34
213 0.38
214 0.47
215 0.54
216 0.6
217 0.69
218 0.74
219 0.8
220 0.86
221 0.87