Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YIE5

Protein Details
Accession G2YIE5    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
25-50LRMESRKKTDARKRKAREVLDKHRKEBasic
86-113LDRVIERRRKKVEGKEKKNMPRARRMVDBasic
NLS Segment(s)
PositionSequence
9-71RKTKDEDEKEKLKRELLRMESRKKTDARKRKAREVLDKHRKEEKELVKEGKTPYYLKKAEQKK
88-110RVIERRRKKVEGKEKKNMPRARR
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MKKLKETIRKTKDEDEKEKLKRELLRMESRKKTDARKRKAREVLDKHRKEEKELVKEGKTPYYLKKAEQKKRVLLDTFGELKGRQLDRVIERRRKKVEGKEKKNMPRARRMVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.73
3 0.73
4 0.72
5 0.74
6 0.67
7 0.63
8 0.59
9 0.57
10 0.57
11 0.56
12 0.6
13 0.6
14 0.67
15 0.69
16 0.67
17 0.67
18 0.63
19 0.65
20 0.65
21 0.68
22 0.7
23 0.73
24 0.76
25 0.8
26 0.84
27 0.81
28 0.81
29 0.8
30 0.81
31 0.81
32 0.78
33 0.71
34 0.71
35 0.64
36 0.57
37 0.56
38 0.53
39 0.49
40 0.5
41 0.5
42 0.43
43 0.46
44 0.43
45 0.37
46 0.31
47 0.25
48 0.24
49 0.29
50 0.29
51 0.29
52 0.36
53 0.44
54 0.51
55 0.57
56 0.59
57 0.58
58 0.61
59 0.63
60 0.56
61 0.48
62 0.41
63 0.37
64 0.34
65 0.28
66 0.24
67 0.19
68 0.19
69 0.24
70 0.23
71 0.19
72 0.18
73 0.23
74 0.29
75 0.4
76 0.47
77 0.51
78 0.57
79 0.66
80 0.7
81 0.72
82 0.74
83 0.75
84 0.77
85 0.78
86 0.8
87 0.82
88 0.85
89 0.88
90 0.89
91 0.87
92 0.83
93 0.82