Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XS13

Protein Details
Accession G2XS13   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-93TKMRTGRRTGRRTGRRTGRRARRATRBasic
NLS Segment(s)
PositionSequence
69-93KMRTGRRTGRRTGRRTGRRARRATR
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
Amino Acid Sequences MYGTLSFGNGSKSKRSSAEFHTFSAFHRRRLRQPACDECRTARVKCRGDPDSENLKCARCQASQLKATKMRTGRRTGRRTGRRTGRRARRATR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.37
4 0.42
5 0.49
6 0.44
7 0.43
8 0.43
9 0.39
10 0.37
11 0.43
12 0.37
13 0.35
14 0.42
15 0.46
16 0.51
17 0.61
18 0.66
19 0.63
20 0.7
21 0.72
22 0.7
23 0.68
24 0.62
25 0.52
26 0.53
27 0.48
28 0.41
29 0.38
30 0.4
31 0.4
32 0.42
33 0.47
34 0.42
35 0.42
36 0.44
37 0.42
38 0.43
39 0.4
40 0.39
41 0.33
42 0.32
43 0.28
44 0.29
45 0.27
46 0.17
47 0.23
48 0.28
49 0.34
50 0.4
51 0.43
52 0.47
53 0.49
54 0.51
55 0.51
56 0.51
57 0.53
58 0.53
59 0.59
60 0.62
61 0.66
62 0.7
63 0.73
64 0.77
65 0.79
66 0.78
67 0.8
68 0.81
69 0.8
70 0.83
71 0.85
72 0.85
73 0.85