Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YI18

Protein Details
Accession G2YI18    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
152-179KSLEKEKLDYRRRTKKDHNGPVERREMRBasic
NLS Segment(s)
PositionSequence
111-169RRSEGRRPQGNPKQKIRERPAKKGAHEVEKRREVESKNEGEKSLEKEKLDYRRRTKKDH
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MTYRPPHSTSQREYCNSNLPQTTQAFGFPPSHLYPLPNSNTPIRDPQYNSRRDYLPQSPKRIKRSYSPLPRPPIGPIPTLRVPSPTLPGPLPRAQTHPSVNPSAYGNITPRRSEGRRPQGNPKQKIRERPAKKGAHEVEKRREVESKNEGEKSLEKEKLDYRRRTKKDHNGPVERREMRSSDAAARGFYRDGDQGNLEKRVRWKGQTFRGDLRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.55
4 0.53
5 0.46
6 0.39
7 0.42
8 0.4
9 0.38
10 0.29
11 0.28
12 0.23
13 0.22
14 0.22
15 0.17
16 0.2
17 0.2
18 0.23
19 0.22
20 0.22
21 0.24
22 0.29
23 0.33
24 0.31
25 0.33
26 0.34
27 0.36
28 0.37
29 0.41
30 0.36
31 0.37
32 0.39
33 0.47
34 0.52
35 0.56
36 0.56
37 0.52
38 0.51
39 0.48
40 0.5
41 0.5
42 0.51
43 0.52
44 0.59
45 0.64
46 0.7
47 0.76
48 0.75
49 0.68
50 0.66
51 0.67
52 0.68
53 0.7
54 0.72
55 0.71
56 0.71
57 0.7
58 0.62
59 0.57
60 0.54
61 0.45
62 0.39
63 0.32
64 0.32
65 0.33
66 0.34
67 0.3
68 0.24
69 0.24
70 0.22
71 0.24
72 0.19
73 0.18
74 0.17
75 0.19
76 0.21
77 0.23
78 0.25
79 0.23
80 0.25
81 0.26
82 0.29
83 0.29
84 0.28
85 0.28
86 0.27
87 0.26
88 0.22
89 0.21
90 0.18
91 0.16
92 0.13
93 0.13
94 0.16
95 0.18
96 0.17
97 0.17
98 0.22
99 0.24
100 0.31
101 0.38
102 0.44
103 0.5
104 0.54
105 0.63
106 0.67
107 0.75
108 0.75
109 0.73
110 0.73
111 0.7
112 0.76
113 0.74
114 0.75
115 0.71
116 0.73
117 0.75
118 0.7
119 0.67
120 0.67
121 0.63
122 0.63
123 0.64
124 0.62
125 0.61
126 0.62
127 0.61
128 0.53
129 0.54
130 0.46
131 0.47
132 0.47
133 0.45
134 0.43
135 0.43
136 0.41
137 0.38
138 0.4
139 0.38
140 0.37
141 0.34
142 0.29
143 0.32
144 0.38
145 0.46
146 0.52
147 0.55
148 0.58
149 0.65
150 0.71
151 0.76
152 0.81
153 0.81
154 0.83
155 0.84
156 0.84
157 0.84
158 0.85
159 0.82
160 0.82
161 0.74
162 0.66
163 0.59
164 0.51
165 0.44
166 0.42
167 0.38
168 0.34
169 0.35
170 0.33
171 0.3
172 0.3
173 0.28
174 0.25
175 0.22
176 0.19
177 0.17
178 0.18
179 0.19
180 0.21
181 0.24
182 0.28
183 0.35
184 0.33
185 0.34
186 0.39
187 0.46
188 0.49
189 0.51
190 0.55
191 0.58
192 0.68
193 0.73
194 0.73