Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YDH9

Protein Details
Accession G2YDH9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
78-99VVISRGSKHRSPRSHRPHHKGSBasic
NLS Segment(s)
PositionSequence
60-99ARAKKESDKQLKRPLHQPVVISRGSKHRSPRSHRPHHKGS
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MSSQLNRYWIPNFDINKRVITKEIQYYLGPESTLRPYTRDEQIDDICIKSKELWEKQAAARAKKESDKQLKRPLHQPVVISRGSKHRSPRSHRPHHKGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.4
3 0.43
4 0.42
5 0.39
6 0.34
7 0.34
8 0.32
9 0.34
10 0.35
11 0.31
12 0.29
13 0.29
14 0.28
15 0.25
16 0.21
17 0.14
18 0.14
19 0.16
20 0.19
21 0.18
22 0.18
23 0.2
24 0.24
25 0.29
26 0.29
27 0.27
28 0.27
29 0.27
30 0.28
31 0.25
32 0.22
33 0.18
34 0.16
35 0.15
36 0.12
37 0.14
38 0.19
39 0.2
40 0.24
41 0.24
42 0.26
43 0.27
44 0.34
45 0.35
46 0.31
47 0.32
48 0.32
49 0.33
50 0.35
51 0.39
52 0.43
53 0.49
54 0.55
55 0.6
56 0.67
57 0.7
58 0.69
59 0.72
60 0.71
61 0.67
62 0.61
63 0.56
64 0.51
65 0.5
66 0.48
67 0.42
68 0.35
69 0.37
70 0.39
71 0.41
72 0.45
73 0.5
74 0.58
75 0.66
76 0.74
77 0.76
78 0.83
79 0.89