Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YNP2

Protein Details
Accession G2YNP2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
25-48VYTASKRGGARRRKKNNNSEGHIEHydrophilic
NLS Segment(s)
PositionSequence
30-39KRGGARRRKK
Subcellular Location(s) nucl 13, cyto 12
Family & Domain DBs
Amino Acid Sequences MFTNVMPVVLHALDAMCANRGCDCVYTASKRGGARRRKKNNNSEGHIEQSPPNELLTGPAPVVSLATPGAGLLQSDEQLDFDMDFDFDPNIQGSQEPLTMNEGFLPQNILEDSFRMETETPVVKTYANDEDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.1
5 0.1
6 0.11
7 0.12
8 0.13
9 0.13
10 0.13
11 0.15
12 0.2
13 0.24
14 0.26
15 0.28
16 0.32
17 0.34
18 0.41
19 0.45
20 0.51
21 0.56
22 0.65
23 0.73
24 0.8
25 0.87
26 0.89
27 0.9
28 0.88
29 0.83
30 0.79
31 0.71
32 0.64
33 0.54
34 0.45
35 0.36
36 0.29
37 0.25
38 0.18
39 0.16
40 0.12
41 0.11
42 0.11
43 0.1
44 0.09
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.03
56 0.04
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.05
74 0.05
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.08
82 0.1
83 0.1
84 0.1
85 0.14
86 0.14
87 0.14
88 0.13
89 0.13
90 0.12
91 0.12
92 0.13
93 0.09
94 0.11
95 0.11
96 0.12
97 0.11
98 0.11
99 0.14
100 0.13
101 0.14
102 0.14
103 0.15
104 0.14
105 0.18
106 0.23
107 0.2
108 0.21
109 0.22
110 0.2
111 0.2
112 0.24