Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y514

Protein Details
Accession G2Y514    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
293-313DGTDSKKKPGRPKGASNGTPAHydrophilic
NLS Segment(s)
PositionSequence
298-335KKKPGRPKGASNGTPAKREKKIPAVGQAQRKTRSQARK
Subcellular Location(s) nucl 16, cyto_nucl 12.833, cyto 7.5, cyto_pero 4.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MADNKIEEGDKVSWSWGGANPDGTAAEVKAGEVSVTSHRGNEIKKTGDEENPAVHIERSGNDVVKLASELKVEDKGEESKEGEESKEGEENKEGEKPKEEEETKEEDNANESKETKEDTKEDTNGEVEDGEKMDETNGEAKDEDKKDETNGDSKDEVNGDSKDETNGEAKVAEEKAETNGESKDEEMTNETNVPDEKVESEEENKKEEDVEMKDGEDKVEEKTTEEKPEEKSEEKSVKADEKKDSNDKEDTPEAKPKAGNKRKADELDDEAESPEENSTKKQKTNATSNGNADGTDSKKKPGRPKGASNGTPAKREKKIPAVGQAQRKTRSQARKESV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.18
4 0.21
5 0.21
6 0.22
7 0.21
8 0.21
9 0.21
10 0.19
11 0.16
12 0.11
13 0.11
14 0.1
15 0.09
16 0.09
17 0.09
18 0.08
19 0.07
20 0.09
21 0.11
22 0.16
23 0.16
24 0.16
25 0.19
26 0.24
27 0.26
28 0.31
29 0.33
30 0.34
31 0.35
32 0.39
33 0.4
34 0.4
35 0.43
36 0.37
37 0.33
38 0.3
39 0.3
40 0.27
41 0.22
42 0.19
43 0.16
44 0.14
45 0.17
46 0.18
47 0.18
48 0.17
49 0.18
50 0.16
51 0.15
52 0.16
53 0.13
54 0.12
55 0.12
56 0.12
57 0.13
58 0.17
59 0.17
60 0.16
61 0.18
62 0.19
63 0.2
64 0.22
65 0.21
66 0.18
67 0.2
68 0.2
69 0.18
70 0.17
71 0.17
72 0.16
73 0.2
74 0.2
75 0.18
76 0.2
77 0.21
78 0.21
79 0.26
80 0.27
81 0.24
82 0.28
83 0.29
84 0.29
85 0.36
86 0.36
87 0.33
88 0.35
89 0.39
90 0.35
91 0.36
92 0.34
93 0.25
94 0.27
95 0.25
96 0.22
97 0.17
98 0.17
99 0.15
100 0.15
101 0.18
102 0.17
103 0.19
104 0.2
105 0.24
106 0.28
107 0.29
108 0.29
109 0.27
110 0.25
111 0.22
112 0.2
113 0.14
114 0.1
115 0.08
116 0.07
117 0.06
118 0.05
119 0.05
120 0.05
121 0.05
122 0.06
123 0.1
124 0.1
125 0.1
126 0.1
127 0.11
128 0.18
129 0.19
130 0.2
131 0.18
132 0.18
133 0.18
134 0.22
135 0.23
136 0.21
137 0.21
138 0.21
139 0.21
140 0.2
141 0.2
142 0.18
143 0.17
144 0.14
145 0.13
146 0.12
147 0.12
148 0.12
149 0.11
150 0.11
151 0.11
152 0.1
153 0.09
154 0.08
155 0.07
156 0.07
157 0.09
158 0.09
159 0.08
160 0.07
161 0.07
162 0.09
163 0.1
164 0.1
165 0.09
166 0.09
167 0.09
168 0.09
169 0.09
170 0.1
171 0.09
172 0.09
173 0.1
174 0.11
175 0.11
176 0.11
177 0.11
178 0.1
179 0.1
180 0.1
181 0.08
182 0.08
183 0.08
184 0.08
185 0.1
186 0.1
187 0.15
188 0.2
189 0.21
190 0.23
191 0.23
192 0.21
193 0.2
194 0.2
195 0.2
196 0.16
197 0.19
198 0.17
199 0.17
200 0.19
201 0.19
202 0.19
203 0.15
204 0.13
205 0.11
206 0.14
207 0.14
208 0.13
209 0.18
210 0.21
211 0.24
212 0.26
213 0.26
214 0.27
215 0.33
216 0.36
217 0.34
218 0.34
219 0.37
220 0.4
221 0.38
222 0.37
223 0.34
224 0.38
225 0.4
226 0.42
227 0.4
228 0.42
229 0.47
230 0.53
231 0.53
232 0.5
233 0.49
234 0.45
235 0.45
236 0.46
237 0.43
238 0.38
239 0.43
240 0.4
241 0.39
242 0.4
243 0.42
244 0.47
245 0.53
246 0.59
247 0.57
248 0.62
249 0.66
250 0.68
251 0.64
252 0.58
253 0.53
254 0.47
255 0.42
256 0.36
257 0.29
258 0.25
259 0.21
260 0.16
261 0.13
262 0.11
263 0.1
264 0.15
265 0.24
266 0.29
267 0.33
268 0.39
269 0.46
270 0.52
271 0.61
272 0.65
273 0.64
274 0.64
275 0.63
276 0.61
277 0.53
278 0.45
279 0.37
280 0.32
281 0.28
282 0.32
283 0.3
284 0.32
285 0.37
286 0.45
287 0.53
288 0.6
289 0.67
290 0.66
291 0.75
292 0.79
293 0.84
294 0.81
295 0.78
296 0.78
297 0.7
298 0.69
299 0.66
300 0.63
301 0.59
302 0.62
303 0.62
304 0.62
305 0.67
306 0.65
307 0.68
308 0.7
309 0.72
310 0.75
311 0.75
312 0.73
313 0.68
314 0.66
315 0.64
316 0.64
317 0.67
318 0.66