Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YNA2

Protein Details
Accession G2YNA2    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
90-139GISCVRARRARRARKARKARKARRHQARCEARGKRQDERKREKEERAYGQBasic
NLS Segment(s)
PositionSequence
95-132RARRARRARKARKARKARRHQARCEARGKRQDERKREK
Subcellular Location(s) nucl 7.5, cyto_nucl 7, pero 7, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MFGSRWASWVSEAADADIQDDANLIDVTLIYVDYGYHFLQPKFQHFFVSTRTGCVNGRWEIAVDENSMGDVDAGQWPAFPFARDVYQREGISCVRARRARRARKARKARKARRHQARCEARGKRQDERKREKEERAYGQGYETNRTVTTSERRRSHNLSAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.17
4 0.14
5 0.12
6 0.08
7 0.08
8 0.07
9 0.07
10 0.07
11 0.06
12 0.05
13 0.05
14 0.06
15 0.05
16 0.05
17 0.03
18 0.04
19 0.04
20 0.05
21 0.07
22 0.08
23 0.11
24 0.14
25 0.15
26 0.21
27 0.24
28 0.29
29 0.32
30 0.32
31 0.32
32 0.31
33 0.33
34 0.31
35 0.36
36 0.3
37 0.26
38 0.26
39 0.26
40 0.24
41 0.24
42 0.24
43 0.18
44 0.19
45 0.17
46 0.16
47 0.15
48 0.16
49 0.15
50 0.1
51 0.09
52 0.08
53 0.08
54 0.07
55 0.06
56 0.04
57 0.03
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.07
65 0.08
66 0.07
67 0.07
68 0.07
69 0.11
70 0.13
71 0.15
72 0.17
73 0.22
74 0.22
75 0.21
76 0.23
77 0.2
78 0.22
79 0.23
80 0.2
81 0.23
82 0.28
83 0.3
84 0.39
85 0.49
86 0.56
87 0.63
88 0.73
89 0.77
90 0.83
91 0.92
92 0.92
93 0.92
94 0.93
95 0.93
96 0.93
97 0.94
98 0.93
99 0.93
100 0.92
101 0.9
102 0.89
103 0.88
104 0.84
105 0.83
106 0.79
107 0.76
108 0.76
109 0.72
110 0.7
111 0.71
112 0.73
113 0.75
114 0.78
115 0.78
116 0.8
117 0.82
118 0.82
119 0.82
120 0.81
121 0.78
122 0.75
123 0.68
124 0.58
125 0.53
126 0.48
127 0.4
128 0.35
129 0.29
130 0.23
131 0.21
132 0.22
133 0.21
134 0.23
135 0.31
136 0.37
137 0.45
138 0.49
139 0.55
140 0.61
141 0.68