Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YV96

Protein Details
Accession G2YV96    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
34-55MDNSRIKGRREPRERKKLSSCYHydrophilic
NLS Segment(s)
PositionSequence
40-50KGRREPRERKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MPLWTGSVLSLPYQYDQGRQHLPCPGEQEEQVDMDNSRIKGRREPRERKKLSSCYLIIDKELITVLVIEGEVRIQCQPCVCNHIMASLAPIISNILPHSQRRLRITLTPQVVINESKRIWLNTCLRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.24
4 0.28
5 0.34
6 0.34
7 0.36
8 0.37
9 0.38
10 0.34
11 0.37
12 0.36
13 0.31
14 0.3
15 0.31
16 0.26
17 0.25
18 0.23
19 0.19
20 0.14
21 0.13
22 0.17
23 0.14
24 0.18
25 0.21
26 0.23
27 0.3
28 0.39
29 0.48
30 0.55
31 0.65
32 0.71
33 0.78
34 0.81
35 0.8
36 0.8
37 0.77
38 0.71
39 0.66
40 0.56
41 0.49
42 0.48
43 0.41
44 0.32
45 0.24
46 0.2
47 0.13
48 0.13
49 0.08
50 0.05
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.05
61 0.06
62 0.07
63 0.08
64 0.1
65 0.1
66 0.17
67 0.17
68 0.18
69 0.17
70 0.18
71 0.18
72 0.16
73 0.17
74 0.1
75 0.1
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.11
83 0.13
84 0.15
85 0.24
86 0.27
87 0.33
88 0.37
89 0.4
90 0.39
91 0.44
92 0.49
93 0.49
94 0.49
95 0.44
96 0.41
97 0.38
98 0.37
99 0.34
100 0.29
101 0.27
102 0.23
103 0.26
104 0.28
105 0.29
106 0.3
107 0.35