Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y798

Protein Details
Accession G2Y798    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-28HHDKPEERRGEKRREEKRRNEGKNTLEBasic
NLS Segment(s)
PositionSequence
8-21ERRGEKRREEKRRN
Subcellular Location(s) cyto 13, cyto_nucl 12.5, nucl 10, mito 3
Family & Domain DBs
Amino Acid Sequences MHHDKPEERRGEKRREEKRRNEGKNTLEPFYYVHGTLGDEEIGHVLRILRGVHICGVIWYGMVCHGVELIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.87
4 0.87
5 0.9
6 0.9
7 0.87
8 0.85
9 0.82
10 0.77
11 0.76
12 0.69
13 0.59
14 0.48
15 0.41
16 0.34
17 0.29
18 0.24
19 0.15
20 0.11
21 0.1
22 0.1
23 0.1
24 0.1
25 0.07
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.07
35 0.07
36 0.08
37 0.09
38 0.1
39 0.11
40 0.12
41 0.11
42 0.1
43 0.11
44 0.09
45 0.08
46 0.07
47 0.06
48 0.07
49 0.08
50 0.07
51 0.07