Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XTX1

Protein Details
Accession G2XTX1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
86-108PVMAGKKSVKHPTKNKIAGKKGAHydrophilic
NLS Segment(s)
PositionSequence
90-115GKKSVKHPTKNKIAGKKGAAGTREKK
Subcellular Location(s) cyto 9, cyto_pero 8.833, mito 8, pero 7.5, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MPPNPRIDNNTLVWNAVSKQLDIAEGFKVIWNRLDHDRLIADMGVANKNAAHHRFRRWISSMAEQSGQMNPGNEDMGDAANNDEPPVMAGKKSVKHPTKNKIAGKKGAAGTREKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.24
4 0.22
5 0.16
6 0.16
7 0.16
8 0.17
9 0.16
10 0.17
11 0.11
12 0.11
13 0.11
14 0.12
15 0.13
16 0.12
17 0.16
18 0.16
19 0.19
20 0.23
21 0.26
22 0.23
23 0.24
24 0.24
25 0.19
26 0.19
27 0.15
28 0.1
29 0.09
30 0.1
31 0.09
32 0.09
33 0.09
34 0.08
35 0.1
36 0.13
37 0.15
38 0.18
39 0.2
40 0.26
41 0.34
42 0.34
43 0.38
44 0.37
45 0.39
46 0.37
47 0.4
48 0.37
49 0.31
50 0.3
51 0.26
52 0.24
53 0.2
54 0.18
55 0.12
56 0.1
57 0.09
58 0.09
59 0.09
60 0.08
61 0.07
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.08
68 0.08
69 0.08
70 0.07
71 0.06
72 0.07
73 0.1
74 0.1
75 0.08
76 0.12
77 0.17
78 0.21
79 0.29
80 0.38
81 0.44
82 0.53
83 0.62
84 0.69
85 0.75
86 0.8
87 0.82
88 0.81
89 0.81
90 0.79
91 0.74
92 0.72
93 0.66
94 0.62
95 0.56