Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y7U1

Protein Details
Accession G2Y7U1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-56EFVNTITCRRNRRRKRDNRSPPGQSLRHydrophilic
NLS Segment(s)
PositionSequence
39-51RNRRRKRDNRSPP
Subcellular Location(s) nucl 20.5, cyto_nucl 13.333, cyto 5, cyto_mito 3.833
Family & Domain DBs
Amino Acid Sequences MDLGLDLLAGIHSNPEPVVTQHEPAPTFGEFVNTITCRRNRRRKRDNRSPPGQSLRAINPRSEKGKYESTSFDHSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.08
4 0.09
5 0.16
6 0.17
7 0.18
8 0.2
9 0.24
10 0.23
11 0.23
12 0.25
13 0.18
14 0.17
15 0.15
16 0.15
17 0.12
18 0.12
19 0.15
20 0.13
21 0.14
22 0.17
23 0.22
24 0.28
25 0.37
26 0.48
27 0.55
28 0.65
29 0.75
30 0.82
31 0.88
32 0.91
33 0.93
34 0.92
35 0.91
36 0.86
37 0.82
38 0.78
39 0.7
40 0.6
41 0.53
42 0.51
43 0.51
44 0.46
45 0.42
46 0.4
47 0.43
48 0.47
49 0.46
50 0.42
51 0.38
52 0.46
53 0.45
54 0.44
55 0.43
56 0.43