Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YJ03

Protein Details
Accession G2YJ03    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MYKPSEVKSRRIKRATKIQLSAHydrophilic
47-87AYATSSRDKRHRDKNPRRRPQNPARKSPPKRAKNANVDTTPHydrophilic
NLS Segment(s)
PositionSequence
40-79PRRISRRAYATSSRDKRHRDKNPRRRPQNPARKSPPKRAK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MYKPSEVKSRRIKRATKIQLSASEERRVNQVKRIPLTSLPRRISRRAYATSSRDKRHRDKNPRRRPQNPARKSPPKRAKNANVDTTPNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.81
4 0.76
5 0.7
6 0.68
7 0.68
8 0.65
9 0.58
10 0.54
11 0.46
12 0.42
13 0.44
14 0.43
15 0.38
16 0.38
17 0.4
18 0.39
19 0.41
20 0.42
21 0.38
22 0.37
23 0.44
24 0.45
25 0.48
26 0.45
27 0.49
28 0.51
29 0.52
30 0.52
31 0.48
32 0.46
33 0.41
34 0.43
35 0.43
36 0.44
37 0.51
38 0.52
39 0.53
40 0.54
41 0.58
42 0.61
43 0.65
44 0.71
45 0.72
46 0.77
47 0.83
48 0.87
49 0.91
50 0.93
51 0.9
52 0.9
53 0.89
54 0.89
55 0.86
56 0.85
57 0.85
58 0.86
59 0.86
60 0.87
61 0.87
62 0.85
63 0.85
64 0.85
65 0.85
66 0.85
67 0.86
68 0.84
69 0.78