Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2XQF0

Protein Details
Accession G2XQF0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-35FVDRRAPRRKSTQIVRERRSHSHydrophilic
NLS Segment(s)
PositionSequence
223-237RRKSRKGSVSSGRER
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
Amino Acid Sequences MCLFGIPKDEDIVFVDRRAPRRKSTQIVRERRSHSSRPVSRVSETVIRQHSHRPSTPMSEVHRHSTSMTEIHRGAPSHRHSSSMTEIHRGAPSHRHSSSMTEIHRTHTPAPPTPKPVTPVPPPASVAPPPPPPPASVGFPPGYAPGYPPPPMSVAPPPSHHFIPPPSPSIMPASPAPSYRDLSPPRVPTPPEESRVELIKVEEEHWPPHSHGRSSPSAIHISRRKSRKGSVSSGRERERDRGDREEIYIQRDRIIERGTPSRHPSSSPSSFARRGSRGSGTPEPVQSGYRTVEGTGWDDRRPITPSGYRVVDGAGTRRGSGVGIGNIHREREWEREKVSPSEFGGRRGSIPYDRPRSSGRFAERERVVMDEGGRRREMYRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.27
3 0.3
4 0.38
5 0.46
6 0.48
7 0.51
8 0.59
9 0.68
10 0.7
11 0.75
12 0.78
13 0.79
14 0.85
15 0.84
16 0.84
17 0.8
18 0.79
19 0.77
20 0.73
21 0.72
22 0.73
23 0.74
24 0.71
25 0.73
26 0.68
27 0.62
28 0.57
29 0.52
30 0.49
31 0.43
32 0.45
33 0.43
34 0.4
35 0.4
36 0.47
37 0.5
38 0.5
39 0.51
40 0.49
41 0.48
42 0.53
43 0.55
44 0.53
45 0.51
46 0.51
47 0.51
48 0.51
49 0.48
50 0.42
51 0.39
52 0.35
53 0.31
54 0.28
55 0.27
56 0.25
57 0.24
58 0.26
59 0.29
60 0.27
61 0.27
62 0.31
63 0.35
64 0.38
65 0.37
66 0.37
67 0.35
68 0.39
69 0.43
70 0.42
71 0.37
72 0.34
73 0.35
74 0.34
75 0.36
76 0.32
77 0.28
78 0.3
79 0.34
80 0.37
81 0.37
82 0.37
83 0.35
84 0.39
85 0.43
86 0.42
87 0.38
88 0.37
89 0.37
90 0.37
91 0.4
92 0.38
93 0.34
94 0.33
95 0.36
96 0.36
97 0.43
98 0.45
99 0.48
100 0.48
101 0.47
102 0.45
103 0.45
104 0.45
105 0.42
106 0.47
107 0.44
108 0.43
109 0.42
110 0.4
111 0.38
112 0.34
113 0.31
114 0.26
115 0.27
116 0.29
117 0.3
118 0.29
119 0.26
120 0.28
121 0.28
122 0.27
123 0.24
124 0.25
125 0.22
126 0.21
127 0.21
128 0.18
129 0.17
130 0.13
131 0.13
132 0.12
133 0.15
134 0.15
135 0.15
136 0.15
137 0.16
138 0.17
139 0.18
140 0.2
141 0.21
142 0.22
143 0.25
144 0.27
145 0.28
146 0.29
147 0.26
148 0.23
149 0.22
150 0.26
151 0.25
152 0.26
153 0.24
154 0.23
155 0.24
156 0.26
157 0.23
158 0.18
159 0.17
160 0.16
161 0.16
162 0.17
163 0.18
164 0.17
165 0.18
166 0.18
167 0.24
168 0.24
169 0.29
170 0.33
171 0.34
172 0.34
173 0.36
174 0.35
175 0.31
176 0.36
177 0.34
178 0.33
179 0.31
180 0.3
181 0.29
182 0.3
183 0.27
184 0.19
185 0.16
186 0.13
187 0.12
188 0.12
189 0.15
190 0.14
191 0.15
192 0.17
193 0.18
194 0.17
195 0.24
196 0.25
197 0.22
198 0.23
199 0.27
200 0.28
201 0.29
202 0.3
203 0.26
204 0.28
205 0.27
206 0.32
207 0.32
208 0.36
209 0.41
210 0.45
211 0.48
212 0.48
213 0.54
214 0.56
215 0.57
216 0.59
217 0.61
218 0.64
219 0.66
220 0.69
221 0.67
222 0.62
223 0.58
224 0.55
225 0.54
226 0.51
227 0.48
228 0.47
229 0.47
230 0.44
231 0.44
232 0.45
233 0.39
234 0.37
235 0.37
236 0.31
237 0.3
238 0.3
239 0.28
240 0.24
241 0.25
242 0.21
243 0.21
244 0.28
245 0.28
246 0.32
247 0.37
248 0.39
249 0.37
250 0.37
251 0.38
252 0.39
253 0.4
254 0.4
255 0.39
256 0.4
257 0.43
258 0.46
259 0.47
260 0.42
261 0.4
262 0.4
263 0.4
264 0.37
265 0.4
266 0.41
267 0.39
268 0.39
269 0.37
270 0.35
271 0.32
272 0.3
273 0.24
274 0.21
275 0.19
276 0.17
277 0.17
278 0.15
279 0.15
280 0.15
281 0.18
282 0.21
283 0.22
284 0.21
285 0.22
286 0.23
287 0.24
288 0.26
289 0.25
290 0.25
291 0.27
292 0.3
293 0.34
294 0.34
295 0.32
296 0.28
297 0.27
298 0.24
299 0.2
300 0.2
301 0.2
302 0.19
303 0.19
304 0.19
305 0.19
306 0.16
307 0.17
308 0.17
309 0.15
310 0.18
311 0.18
312 0.25
313 0.26
314 0.27
315 0.25
316 0.24
317 0.25
318 0.31
319 0.36
320 0.35
321 0.37
322 0.42
323 0.47
324 0.49
325 0.48
326 0.43
327 0.4
328 0.45
329 0.43
330 0.41
331 0.42
332 0.37
333 0.36
334 0.35
335 0.37
336 0.33
337 0.4
338 0.46
339 0.5
340 0.51
341 0.52
342 0.56
343 0.57
344 0.57
345 0.58
346 0.56
347 0.56
348 0.58
349 0.64
350 0.6
351 0.57
352 0.52
353 0.45
354 0.39
355 0.32
356 0.32
357 0.31
358 0.34
359 0.36
360 0.36
361 0.35
362 0.35