Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y8E9

Protein Details
Accession G2Y8E9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-53KYSQLSSRTRREKPIRRRKPKNRVSDRHAQTHydrophilic
NLS Segment(s)
PositionSequence
30-45RTRREKPIRRRKPKNR
Subcellular Location(s) mito 19.5, mito_nucl 12.833, nucl 5, cyto_nucl 3.833
Family & Domain DBs
Amino Acid Sequences MSPFFLTHSGASYPRKNHRQVLKYSQLSSRTRREKPIRRRKPKNRVSDRHAQTSRFKIHYQGETKGKLVVLCISHEMTPRVTVHMWRCVWPKLSSSYIVIGREA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.53
3 0.56
4 0.62
5 0.67
6 0.69
7 0.7
8 0.73
9 0.73
10 0.68
11 0.66
12 0.63
13 0.6
14 0.57
15 0.56
16 0.56
17 0.54
18 0.54
19 0.61
20 0.67
21 0.7
22 0.76
23 0.81
24 0.83
25 0.85
26 0.93
27 0.94
28 0.94
29 0.93
30 0.93
31 0.92
32 0.89
33 0.84
34 0.83
35 0.76
36 0.75
37 0.68
38 0.6
39 0.53
40 0.52
41 0.5
42 0.42
43 0.38
44 0.34
45 0.36
46 0.39
47 0.38
48 0.38
49 0.38
50 0.37
51 0.37
52 0.34
53 0.3
54 0.23
55 0.2
56 0.17
57 0.13
58 0.13
59 0.14
60 0.14
61 0.15
62 0.17
63 0.17
64 0.15
65 0.17
66 0.16
67 0.17
68 0.17
69 0.22
70 0.24
71 0.31
72 0.32
73 0.34
74 0.38
75 0.39
76 0.43
77 0.39
78 0.39
79 0.36
80 0.38
81 0.35
82 0.33
83 0.34
84 0.34