Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2XTK7

Protein Details
Accession G2XTK7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPPRKVAKPRDSRPRAAKVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 11
Family & Domain DBs
Amino Acid Sequences MPPRKVAKPRDSRPRAAKVIEIGSEVANNGGGEPDTIKKLVQRGVESLNIDKESTGGSGCMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.75
3 0.66
4 0.59
5 0.51
6 0.47
7 0.38
8 0.31
9 0.23
10 0.18
11 0.16
12 0.13
13 0.09
14 0.07
15 0.06
16 0.05
17 0.04
18 0.04
19 0.04
20 0.05
21 0.06
22 0.07
23 0.07
24 0.08
25 0.09
26 0.13
27 0.17
28 0.2
29 0.2
30 0.22
31 0.25
32 0.29
33 0.29
34 0.28
35 0.28
36 0.25
37 0.23
38 0.2
39 0.18
40 0.15
41 0.14
42 0.12