Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XS39

Protein Details
Accession G2XS39    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPANTGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 12, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPANTGAKKQKKKWSKGKVKDKAQHAVILDKSTSDRLAKDVQSYRLVTVAVLVDRLKINGSLARRCLKELEEKGQIKIVVKHHAGDIYTRAIQADE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.89
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.5
15 0.4
16 0.35
17 0.28
18 0.2
19 0.19
20 0.17
21 0.17
22 0.13
23 0.12
24 0.13
25 0.17
26 0.17
27 0.22
28 0.24
29 0.25
30 0.28
31 0.28
32 0.25
33 0.22
34 0.21
35 0.15
36 0.12
37 0.1
38 0.06
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.14
49 0.16
50 0.2
51 0.25
52 0.25
53 0.26
54 0.27
55 0.27
56 0.33
57 0.34
58 0.37
59 0.41
60 0.42
61 0.42
62 0.43
63 0.42
64 0.35
65 0.37
66 0.34
67 0.33
68 0.33
69 0.33
70 0.31
71 0.32
72 0.29
73 0.26
74 0.25
75 0.22
76 0.22
77 0.21