Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XQL4

Protein Details
Accession G2XQL4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-69LKTLREGKYEEKRKRRRGRGEFELFIBasic
NLS Segment(s)
PositionSequence
53-62EEKRKRRRGR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MKKGYPEGSNQKFPRWGPRRIPNDSRRPDVQWRTRIIALSILDLKTLREGKYEEKRKRRRGRGEFELFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.54
3 0.56
4 0.55
5 0.63
6 0.66
7 0.68
8 0.76
9 0.74
10 0.78
11 0.75
12 0.71
13 0.64
14 0.61
15 0.62
16 0.61
17 0.6
18 0.55
19 0.53
20 0.51
21 0.49
22 0.45
23 0.36
24 0.31
25 0.23
26 0.18
27 0.17
28 0.14
29 0.13
30 0.13
31 0.13
32 0.14
33 0.16
34 0.15
35 0.15
36 0.17
37 0.25
38 0.36
39 0.47
40 0.52
41 0.6
42 0.71
43 0.79
44 0.88
45 0.91
46 0.91
47 0.91
48 0.91
49 0.91