Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YPY1

Protein Details
Accession G2YPY1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
168-189TSLPSEKESKKRQKLTQSSEIAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 10.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MEVYKSVYDLMLAKAISYGYVKEQVLDILSESHDRVKLSTFKNIPDGEKYWMAERWTWETLFADESAEFPGEKPKWKRVSKYLKQNLPAAGETPKSTQVKANDSTASPKPKPKLRYFPAARPQNLGDKTSEVPISMPKRIFCVDTPTEKSSGEKVPKSATRLPKTSPTSLPSEKESKKRQKLTQSSEIADEKDLRLPGGVSTTFSQLIDAKIQKNKPTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.12
5 0.12
6 0.12
7 0.18
8 0.18
9 0.17
10 0.18
11 0.18
12 0.17
13 0.17
14 0.14
15 0.1
16 0.11
17 0.12
18 0.12
19 0.15
20 0.16
21 0.16
22 0.16
23 0.2
24 0.26
25 0.28
26 0.36
27 0.35
28 0.36
29 0.42
30 0.44
31 0.41
32 0.38
33 0.38
34 0.33
35 0.33
36 0.32
37 0.28
38 0.29
39 0.28
40 0.25
41 0.26
42 0.27
43 0.26
44 0.25
45 0.24
46 0.22
47 0.21
48 0.2
49 0.17
50 0.12
51 0.1
52 0.1
53 0.1
54 0.1
55 0.09
56 0.08
57 0.15
58 0.16
59 0.24
60 0.27
61 0.35
62 0.44
63 0.49
64 0.55
65 0.58
66 0.68
67 0.68
68 0.76
69 0.76
70 0.72
71 0.7
72 0.68
73 0.6
74 0.51
75 0.43
76 0.33
77 0.26
78 0.21
79 0.19
80 0.16
81 0.2
82 0.18
83 0.19
84 0.21
85 0.22
86 0.27
87 0.27
88 0.28
89 0.23
90 0.23
91 0.27
92 0.27
93 0.3
94 0.27
95 0.3
96 0.32
97 0.37
98 0.44
99 0.47
100 0.53
101 0.5
102 0.59
103 0.59
104 0.63
105 0.66
106 0.67
107 0.6
108 0.53
109 0.5
110 0.47
111 0.44
112 0.37
113 0.28
114 0.23
115 0.23
116 0.22
117 0.2
118 0.13
119 0.12
120 0.17
121 0.19
122 0.21
123 0.22
124 0.2
125 0.23
126 0.24
127 0.25
128 0.2
129 0.24
130 0.24
131 0.29
132 0.34
133 0.33
134 0.33
135 0.32
136 0.32
137 0.28
138 0.32
139 0.32
140 0.29
141 0.29
142 0.34
143 0.37
144 0.42
145 0.46
146 0.48
147 0.48
148 0.5
149 0.51
150 0.54
151 0.57
152 0.55
153 0.52
154 0.45
155 0.46
156 0.47
157 0.46
158 0.42
159 0.45
160 0.46
161 0.51
162 0.59
163 0.62
164 0.68
165 0.75
166 0.78
167 0.79
168 0.84
169 0.84
170 0.83
171 0.77
172 0.69
173 0.65
174 0.59
175 0.5
176 0.42
177 0.35
178 0.26
179 0.25
180 0.23
181 0.18
182 0.17
183 0.16
184 0.15
185 0.18
186 0.17
187 0.15
188 0.16
189 0.19
190 0.19
191 0.19
192 0.2
193 0.17
194 0.19
195 0.23
196 0.26
197 0.29
198 0.37
199 0.42