Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XPB8

Protein Details
Accession G2XPB8    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-74QITRRMSKAKQTKRSKVKPFIKVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto_nucl 5.5, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR041991  KOW_RPL27  
IPR038655  L27e_sf  
IPR001141  Ribosomal_L27e  
IPR018262  Ribosomal_L27e_CS  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01777  Ribosomal_L27e  
PROSITE View protein in PROSITE  
PS01107  RIBOSOMAL_L27E  
CDD cd06090  KOW_RPL27  
Amino Acid Sequences MKFLKTGRVAIITRGRYAGKKVVIIQPQDAGNKSHPYPHALVAGIERYPSQITRRMSKAKQTKRSKVKPFIKVINYNHLMPTRYTLELEGLKGVVSADTFKEVSQREEAKKTVKKALEERYTSGKNRWFFTPLRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.33
4 0.36
5 0.36
6 0.31
7 0.31
8 0.34
9 0.39
10 0.42
11 0.42
12 0.39
13 0.35
14 0.35
15 0.34
16 0.32
17 0.27
18 0.25
19 0.27
20 0.26
21 0.28
22 0.26
23 0.29
24 0.29
25 0.29
26 0.27
27 0.23
28 0.23
29 0.19
30 0.19
31 0.14
32 0.13
33 0.1
34 0.09
35 0.1
36 0.11
37 0.12
38 0.17
39 0.2
40 0.25
41 0.31
42 0.36
43 0.38
44 0.45
45 0.53
46 0.56
47 0.64
48 0.68
49 0.73
50 0.76
51 0.84
52 0.84
53 0.84
54 0.83
55 0.8
56 0.76
57 0.74
58 0.69
59 0.67
60 0.6
61 0.58
62 0.52
63 0.44
64 0.41
65 0.35
66 0.31
67 0.23
68 0.24
69 0.19
70 0.17
71 0.17
72 0.15
73 0.16
74 0.16
75 0.16
76 0.13
77 0.1
78 0.09
79 0.09
80 0.08
81 0.06
82 0.05
83 0.06
84 0.06
85 0.08
86 0.09
87 0.09
88 0.14
89 0.15
90 0.17
91 0.23
92 0.29
93 0.31
94 0.35
95 0.38
96 0.43
97 0.48
98 0.5
99 0.51
100 0.5
101 0.52
102 0.55
103 0.63
104 0.62
105 0.6
106 0.59
107 0.6
108 0.61
109 0.57
110 0.56
111 0.53
112 0.48
113 0.48
114 0.47
115 0.44