Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YWP2

Protein Details
Accession G2YWP2    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
91-115SKVGSKSKNRISKRKVSSRKSQMTFHydrophilic
NLS Segment(s)
PositionSequence
96-110KSKNRISKRKVSSRK
Subcellular Location(s) nucl 21, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGARSSSIKANNSALKSKVFGPVENARAERMHAKLMELISQPKPSAKTEDVDMEAKEGKDGEASAKDTSNAAAAAQEKPSEEMEVDAISKVGSKSKNRISKRKVSSRKSQMTFTTYKNGKKVGGGRKQKIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.43
4 0.36
5 0.35
6 0.33
7 0.35
8 0.31
9 0.28
10 0.3
11 0.34
12 0.36
13 0.37
14 0.36
15 0.29
16 0.28
17 0.29
18 0.27
19 0.22
20 0.22
21 0.19
22 0.19
23 0.2
24 0.21
25 0.22
26 0.2
27 0.22
28 0.21
29 0.22
30 0.21
31 0.21
32 0.23
33 0.21
34 0.25
35 0.23
36 0.22
37 0.22
38 0.24
39 0.24
40 0.23
41 0.22
42 0.17
43 0.17
44 0.15
45 0.14
46 0.11
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.09
53 0.1
54 0.1
55 0.1
56 0.1
57 0.1
58 0.09
59 0.07
60 0.05
61 0.06
62 0.07
63 0.08
64 0.09
65 0.09
66 0.09
67 0.1
68 0.11
69 0.1
70 0.09
71 0.08
72 0.08
73 0.08
74 0.08
75 0.07
76 0.06
77 0.05
78 0.07
79 0.07
80 0.11
81 0.16
82 0.2
83 0.27
84 0.37
85 0.47
86 0.53
87 0.64
88 0.67
89 0.72
90 0.78
91 0.82
92 0.83
93 0.81
94 0.83
95 0.84
96 0.86
97 0.79
98 0.74
99 0.68
100 0.64
101 0.62
102 0.54
103 0.54
104 0.49
105 0.51
106 0.5
107 0.49
108 0.43
109 0.46
110 0.51
111 0.51
112 0.56
113 0.61