Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YV09

Protein Details
Accession G2YV09    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
22-41ATKARYQKVQVKPKHHHCKRBasic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
Amino Acid Sequences MRIRIPIFTQTLHLPNSASVSATKARYQKVQVKPKHHHCKRSAYANVSTGPFGVRLRLGMLELAPEKDQGKGCFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.22
4 0.19
5 0.15
6 0.12
7 0.14
8 0.17
9 0.18
10 0.22
11 0.23
12 0.25
13 0.29
14 0.35
15 0.41
16 0.47
17 0.55
18 0.57
19 0.62
20 0.69
21 0.76
22 0.81
23 0.77
24 0.76
25 0.71
26 0.75
27 0.7
28 0.7
29 0.65
30 0.58
31 0.55
32 0.49
33 0.46
34 0.37
35 0.32
36 0.23
37 0.18
38 0.15
39 0.12
40 0.11
41 0.09
42 0.08
43 0.1
44 0.1
45 0.1
46 0.09
47 0.09
48 0.12
49 0.13
50 0.14
51 0.14
52 0.15
53 0.15
54 0.19
55 0.24