Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y225

Protein Details
Accession G2Y225    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
245-276GIVKPKPTPRVPKPPKEPKAPKEPKPAKEPKABasic
328-348ATPSSGKKRGRPAKEKTSDTPHydrophilic
NLS Segment(s)
PositionSequence
209-380REKPAPSGRGRGRPAKPDSEKKIKVPSGRGRGRPSSGIVKPKPTPRVPKPPKEPKAPKEPKPAKEPKAPKEPKPAKEPKAAKTPKSPKEKAVVEKKTPGKRGRPAKVPAAEGDVDEKPAATPSSGKKRGRPAKEKTSDTPASATPASKKRKASDDAGTPSSAGRGRPKKVKA
Subcellular Location(s) cyto_nucl 14.333, nucl 14, cyto 11.5, mito_nucl 8.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSSPNDITLAEFNQTLARYPDLLNKYAKDAKEGVTPLQELDRFRYVEAPAKFKDGSHTFSIEDITKLVDWKLRHGAYRPGFLKKVGKNSDELVEAATKDAFDYYKTNPTDIGVVINKLKDPLMGIGPATASLILSVRYPDQVTFFSDECFKWLVNDGEHKPTPKYNVAEFEKIHAAAKSLATRLRVNPLQIEKVAFVIIKESEPVLVPREKPAPSGRGRGRPAKPDSEKKIKVPSGRGRGRPSSGIVKPKPTPRVPKPPKEPKAPKEPKPAKEPKAPKEPKPAKEPKAAKTPKSPKEKAVVEKKTPGKRGRPAKVPAAEGDVDEKPAATPSSGKKRGRPAKEKTSDTPASATPASKKRKASDDAGTPSSAGRGRPKKVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.18
5 0.18
6 0.2
7 0.28
8 0.29
9 0.33
10 0.35
11 0.34
12 0.39
13 0.44
14 0.42
15 0.38
16 0.37
17 0.35
18 0.38
19 0.39
20 0.34
21 0.32
22 0.32
23 0.28
24 0.31
25 0.31
26 0.25
27 0.29
28 0.32
29 0.28
30 0.28
31 0.31
32 0.28
33 0.33
34 0.35
35 0.36
36 0.32
37 0.36
38 0.36
39 0.32
40 0.38
41 0.34
42 0.35
43 0.33
44 0.34
45 0.29
46 0.3
47 0.32
48 0.24
49 0.21
50 0.16
51 0.14
52 0.13
53 0.13
54 0.14
55 0.16
56 0.15
57 0.2
58 0.28
59 0.29
60 0.31
61 0.33
62 0.42
63 0.41
64 0.5
65 0.48
66 0.45
67 0.44
68 0.45
69 0.51
70 0.46
71 0.52
72 0.49
73 0.48
74 0.44
75 0.45
76 0.44
77 0.36
78 0.31
79 0.23
80 0.18
81 0.16
82 0.15
83 0.12
84 0.1
85 0.08
86 0.09
87 0.08
88 0.08
89 0.11
90 0.14
91 0.22
92 0.23
93 0.23
94 0.22
95 0.23
96 0.23
97 0.2
98 0.21
99 0.14
100 0.15
101 0.16
102 0.17
103 0.16
104 0.15
105 0.15
106 0.11
107 0.11
108 0.1
109 0.1
110 0.1
111 0.1
112 0.09
113 0.09
114 0.09
115 0.08
116 0.06
117 0.04
118 0.04
119 0.05
120 0.05
121 0.05
122 0.06
123 0.06
124 0.08
125 0.09
126 0.09
127 0.1
128 0.11
129 0.13
130 0.15
131 0.15
132 0.14
133 0.16
134 0.16
135 0.16
136 0.16
137 0.13
138 0.11
139 0.14
140 0.15
141 0.14
142 0.21
143 0.21
144 0.26
145 0.28
146 0.29
147 0.27
148 0.27
149 0.3
150 0.29
151 0.29
152 0.25
153 0.32
154 0.34
155 0.37
156 0.35
157 0.33
158 0.29
159 0.27
160 0.25
161 0.17
162 0.14
163 0.11
164 0.13
165 0.12
166 0.12
167 0.13
168 0.15
169 0.16
170 0.17
171 0.21
172 0.21
173 0.2
174 0.23
175 0.23
176 0.23
177 0.22
178 0.21
179 0.15
180 0.14
181 0.14
182 0.1
183 0.08
184 0.07
185 0.07
186 0.06
187 0.07
188 0.06
189 0.06
190 0.06
191 0.07
192 0.09
193 0.11
194 0.12
195 0.14
196 0.19
197 0.19
198 0.21
199 0.24
200 0.28
201 0.28
202 0.37
203 0.39
204 0.43
205 0.47
206 0.53
207 0.54
208 0.55
209 0.56
210 0.57
211 0.59
212 0.59
213 0.63
214 0.64
215 0.63
216 0.58
217 0.63
218 0.58
219 0.56
220 0.56
221 0.57
222 0.57
223 0.61
224 0.64
225 0.61
226 0.61
227 0.58
228 0.51
229 0.46
230 0.43
231 0.41
232 0.45
233 0.41
234 0.43
235 0.45
236 0.5
237 0.55
238 0.53
239 0.59
240 0.58
241 0.67
242 0.7
243 0.75
244 0.79
245 0.82
246 0.83
247 0.84
248 0.86
249 0.81
250 0.83
251 0.82
252 0.8
253 0.8
254 0.82
255 0.76
256 0.77
257 0.8
258 0.75
259 0.76
260 0.77
261 0.74
262 0.76
263 0.76
264 0.73
265 0.74
266 0.77
267 0.72
268 0.74
269 0.76
270 0.7
271 0.74
272 0.74
273 0.69
274 0.71
275 0.71
276 0.65
277 0.67
278 0.71
279 0.7
280 0.74
281 0.71
282 0.65
283 0.68
284 0.7
285 0.69
286 0.69
287 0.69
288 0.64
289 0.69
290 0.73
291 0.72
292 0.74
293 0.72
294 0.7
295 0.71
296 0.77
297 0.76
298 0.77
299 0.74
300 0.75
301 0.71
302 0.65
303 0.57
304 0.51
305 0.43
306 0.35
307 0.34
308 0.25
309 0.21
310 0.19
311 0.17
312 0.12
313 0.14
314 0.14
315 0.1
316 0.15
317 0.22
318 0.34
319 0.43
320 0.47
321 0.51
322 0.62
323 0.71
324 0.77
325 0.78
326 0.76
327 0.78
328 0.84
329 0.84
330 0.78
331 0.77
332 0.7
333 0.62
334 0.55
335 0.45
336 0.41
337 0.36
338 0.34
339 0.33
340 0.39
341 0.45
342 0.48
343 0.54
344 0.55
345 0.62
346 0.65
347 0.64
348 0.64
349 0.65
350 0.65
351 0.61
352 0.55
353 0.47
354 0.41
355 0.39
356 0.32
357 0.27
358 0.31
359 0.37
360 0.44