Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XVN1

Protein Details
Accession G2XVN1    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
115-136NGKAKGKKKTGGSKSDKKRIKIBasic
NLS Segment(s)
PositionSequence
83-88KSKPRR
116-135GKAKGKKKTGGSKSDKKRIK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MTSRPSPNDKPPDNLDRPHQVARSKISERENRRAVTYPLVHDRHKGNPAKNKVIRVREPSSSSSNNNRKVEPDVNDQKQRPDKSKPRRLIASIFGRKKADQTTRNHEGEEMNVENGKAKGKKKTGGSKSDKKRIKIPTLGQYIMNEGPGRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.59
3 0.57
4 0.58
5 0.58
6 0.55
7 0.49
8 0.48
9 0.5
10 0.51
11 0.46
12 0.48
13 0.51
14 0.55
15 0.6
16 0.65
17 0.65
18 0.59
19 0.59
20 0.56
21 0.5
22 0.48
23 0.43
24 0.38
25 0.4
26 0.43
27 0.4
28 0.4
29 0.41
30 0.39
31 0.44
32 0.46
33 0.44
34 0.5
35 0.56
36 0.63
37 0.63
38 0.65
39 0.64
40 0.65
41 0.64
42 0.62
43 0.59
44 0.53
45 0.52
46 0.48
47 0.46
48 0.42
49 0.39
50 0.42
51 0.47
52 0.51
53 0.49
54 0.46
55 0.42
56 0.44
57 0.45
58 0.38
59 0.39
60 0.39
61 0.42
62 0.47
63 0.46
64 0.47
65 0.49
66 0.48
67 0.44
68 0.46
69 0.51
70 0.57
71 0.66
72 0.67
73 0.66
74 0.67
75 0.65
76 0.59
77 0.56
78 0.56
79 0.55
80 0.51
81 0.48
82 0.46
83 0.43
84 0.43
85 0.42
86 0.41
87 0.39
88 0.43
89 0.49
90 0.55
91 0.55
92 0.52
93 0.46
94 0.38
95 0.32
96 0.3
97 0.23
98 0.16
99 0.15
100 0.15
101 0.16
102 0.16
103 0.2
104 0.21
105 0.24
106 0.32
107 0.37
108 0.44
109 0.5
110 0.6
111 0.63
112 0.69
113 0.74
114 0.76
115 0.8
116 0.84
117 0.83
118 0.76
119 0.75
120 0.74
121 0.73
122 0.72
123 0.7
124 0.69
125 0.7
126 0.67
127 0.61
128 0.52
129 0.48
130 0.4
131 0.35
132 0.26