Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y5N1

Protein Details
Accession G2Y5N1    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-82SQQGSWYTRHVRKRKLSFKDIQGNKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MPTFNGYQSGPRIEILSRIPCTSSRSLRSSKVQDEDHYSHCHQDACLPESSITDIFSQQGSWYTRHVRKRKLSFKDIQGNKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.27
4 0.25
5 0.25
6 0.26
7 0.26
8 0.31
9 0.33
10 0.35
11 0.33
12 0.37
13 0.4
14 0.43
15 0.49
16 0.49
17 0.48
18 0.47
19 0.43
20 0.4
21 0.44
22 0.42
23 0.38
24 0.36
25 0.32
26 0.28
27 0.27
28 0.25
29 0.17
30 0.18
31 0.18
32 0.17
33 0.17
34 0.17
35 0.16
36 0.16
37 0.18
38 0.15
39 0.13
40 0.1
41 0.1
42 0.1
43 0.1
44 0.09
45 0.08
46 0.13
47 0.14
48 0.15
49 0.19
50 0.27
51 0.34
52 0.45
53 0.53
54 0.57
55 0.66
56 0.75
57 0.81
58 0.82
59 0.83
60 0.82
61 0.83
62 0.84