Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y6H1

Protein Details
Accession G2Y6H1    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
35-54ERLFKELKERRSRKERWSAABasic
123-149EKKWNVTKVERDRKKRDRDQKLQEAWEBasic
NLS Segment(s)
PositionSequence
39-50KELKERRSRKER
136-137KK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
Amino Acid Sequences MMTGHHRHRHSSHRHDGHNGSRGAEEQHRDQGSRERLFKELKERRSRKERWSAAREVVEGNRGTPWWFEMNESEHRIKKWMAEELEDKEIRNANEWNKAQELKQIRQCVYDRDRKHHALAMAEKKWNVTKVERDRKKRDRDQKLQEAWEKESNRWVEELEVADSYDNRNTGPDEDGVTWSRQSLVTINNDIRKRHLSRCIPSLQKPNSRGAHCMDCEDENETGPFWNEVHRLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.76
4 0.73
5 0.71
6 0.61
7 0.52
8 0.44
9 0.41
10 0.38
11 0.36
12 0.32
13 0.28
14 0.35
15 0.35
16 0.35
17 0.36
18 0.41
19 0.44
20 0.47
21 0.48
22 0.42
23 0.45
24 0.49
25 0.5
26 0.52
27 0.52
28 0.56
29 0.62
30 0.66
31 0.71
32 0.77
33 0.8
34 0.78
35 0.8
36 0.79
37 0.78
38 0.79
39 0.75
40 0.71
41 0.66
42 0.58
43 0.49
44 0.41
45 0.36
46 0.29
47 0.24
48 0.18
49 0.16
50 0.16
51 0.13
52 0.14
53 0.12
54 0.13
55 0.14
56 0.15
57 0.19
58 0.24
59 0.28
60 0.3
61 0.3
62 0.3
63 0.31
64 0.29
65 0.28
66 0.27
67 0.28
68 0.25
69 0.26
70 0.29
71 0.3
72 0.35
73 0.32
74 0.28
75 0.24
76 0.26
77 0.23
78 0.22
79 0.22
80 0.19
81 0.27
82 0.28
83 0.28
84 0.27
85 0.28
86 0.26
87 0.28
88 0.31
89 0.28
90 0.33
91 0.36
92 0.34
93 0.38
94 0.38
95 0.39
96 0.4
97 0.43
98 0.4
99 0.41
100 0.47
101 0.44
102 0.45
103 0.4
104 0.35
105 0.3
106 0.34
107 0.35
108 0.32
109 0.31
110 0.3
111 0.28
112 0.28
113 0.27
114 0.23
115 0.19
116 0.26
117 0.35
118 0.46
119 0.53
120 0.61
121 0.69
122 0.75
123 0.82
124 0.83
125 0.83
126 0.83
127 0.85
128 0.86
129 0.85
130 0.81
131 0.77
132 0.73
133 0.65
134 0.58
135 0.56
136 0.47
137 0.38
138 0.39
139 0.34
140 0.29
141 0.27
142 0.23
143 0.17
144 0.17
145 0.17
146 0.12
147 0.11
148 0.1
149 0.1
150 0.1
151 0.1
152 0.1
153 0.09
154 0.08
155 0.09
156 0.1
157 0.12
158 0.14
159 0.13
160 0.14
161 0.15
162 0.18
163 0.18
164 0.18
165 0.17
166 0.15
167 0.15
168 0.13
169 0.13
170 0.13
171 0.16
172 0.19
173 0.24
174 0.29
175 0.34
176 0.38
177 0.38
178 0.4
179 0.43
180 0.44
181 0.46
182 0.52
183 0.53
184 0.56
185 0.62
186 0.66
187 0.64
188 0.67
189 0.7
190 0.68
191 0.68
192 0.66
193 0.68
194 0.67
195 0.62
196 0.58
197 0.54
198 0.54
199 0.46
200 0.46
201 0.4
202 0.33
203 0.33
204 0.32
205 0.27
206 0.2
207 0.2
208 0.17
209 0.16
210 0.16
211 0.15
212 0.12
213 0.17
214 0.17