Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YYV0

Protein Details
Accession G2YYV0    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MYHKRSKKRKLCDMKILYFQFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 13.333, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MYHKRSKKRKLCDMKILYFQFRSRYLENKFCLRILSNLLSIPNFESEDKTKRTRVSNLRIPAVLRSASENLGMEEIVDRSDSEYLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.76
4 0.68
5 0.6
6 0.53
7 0.46
8 0.41
9 0.4
10 0.33
11 0.36
12 0.38
13 0.43
14 0.44
15 0.45
16 0.44
17 0.39
18 0.38
19 0.32
20 0.27
21 0.24
22 0.23
23 0.18
24 0.17
25 0.17
26 0.16
27 0.15
28 0.13
29 0.1
30 0.09
31 0.08
32 0.1
33 0.13
34 0.18
35 0.21
36 0.24
37 0.26
38 0.29
39 0.33
40 0.4
41 0.46
42 0.5
43 0.55
44 0.56
45 0.55
46 0.53
47 0.49
48 0.42
49 0.36
50 0.28
51 0.2
52 0.19
53 0.18
54 0.17
55 0.18
56 0.17
57 0.14
58 0.14
59 0.13
60 0.1
61 0.09
62 0.09
63 0.08
64 0.08
65 0.07
66 0.09