Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YQT4

Protein Details
Accession G2YQT4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTSDRKSQKSATKPPRKPTQTDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 13.333, mito_nucl 13.333
Family & Domain DBs
Amino Acid Sequences MTSDRKSQKSATKPPRKPTQTDLPTQSASTSTTPKHKIPGISLISGSEREEKRRQENKEANDVIDSIKFKEMEMSGMRNRTITSLHSPGKREVNRLWAEYENAKKEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.87
3 0.83
4 0.78
5 0.75
6 0.75
7 0.69
8 0.69
9 0.65
10 0.59
11 0.54
12 0.49
13 0.42
14 0.31
15 0.28
16 0.23
17 0.2
18 0.18
19 0.24
20 0.28
21 0.29
22 0.32
23 0.33
24 0.33
25 0.32
26 0.38
27 0.33
28 0.3
29 0.28
30 0.25
31 0.23
32 0.21
33 0.2
34 0.18
35 0.16
36 0.2
37 0.26
38 0.29
39 0.38
40 0.45
41 0.47
42 0.51
43 0.57
44 0.56
45 0.6
46 0.56
47 0.47
48 0.4
49 0.36
50 0.27
51 0.23
52 0.2
53 0.12
54 0.13
55 0.13
56 0.12
57 0.15
58 0.14
59 0.15
60 0.17
61 0.2
62 0.21
63 0.24
64 0.24
65 0.21
66 0.21
67 0.19
68 0.18
69 0.18
70 0.21
71 0.26
72 0.32
73 0.36
74 0.38
75 0.42
76 0.51
77 0.5
78 0.49
79 0.45
80 0.49
81 0.48
82 0.47
83 0.47
84 0.39
85 0.4
86 0.42
87 0.46
88 0.44