Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YGH5

Protein Details
Accession G2YGH5    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-47TSDSTPPIHHRQNRRRERPGSRARRTISHydrophilic
NLS Segment(s)
PositionSequence
30-48RQNRRRERPGSRARRTISR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVTTKLSSSSSSSSPPLPHTSDSTPPIHHRQNRRRERPGSRARRTISRKSALATDLNEGILEARDSDFYIPNHRPGSGPSPILRQSFDQSWMRWKARQAAELEHLAIKQNMRQLEMERQTMVREAKGREEEELGKMQRRLFGGEEDDEDVSCDIDLCPAMLDVVMRLFDGEVDYLDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.32
4 0.32
5 0.33
6 0.35
7 0.37
8 0.39
9 0.41
10 0.4
11 0.38
12 0.41
13 0.46
14 0.5
15 0.54
16 0.59
17 0.64
18 0.72
19 0.79
20 0.84
21 0.85
22 0.86
23 0.87
24 0.86
25 0.87
26 0.87
27 0.84
28 0.83
29 0.77
30 0.77
31 0.76
32 0.75
33 0.73
34 0.67
35 0.61
36 0.54
37 0.53
38 0.46
39 0.41
40 0.33
41 0.26
42 0.2
43 0.19
44 0.17
45 0.13
46 0.11
47 0.08
48 0.07
49 0.05
50 0.05
51 0.05
52 0.06
53 0.07
54 0.1
55 0.1
56 0.17
57 0.18
58 0.21
59 0.22
60 0.22
61 0.21
62 0.21
63 0.25
64 0.22
65 0.22
66 0.19
67 0.22
68 0.25
69 0.26
70 0.24
71 0.2
72 0.2
73 0.19
74 0.23
75 0.21
76 0.18
77 0.24
78 0.29
79 0.29
80 0.29
81 0.3
82 0.34
83 0.34
84 0.38
85 0.33
86 0.3
87 0.31
88 0.3
89 0.29
90 0.21
91 0.18
92 0.15
93 0.14
94 0.11
95 0.1
96 0.13
97 0.13
98 0.14
99 0.15
100 0.17
101 0.25
102 0.28
103 0.28
104 0.25
105 0.25
106 0.24
107 0.27
108 0.25
109 0.19
110 0.2
111 0.2
112 0.25
113 0.29
114 0.29
115 0.26
116 0.29
117 0.28
118 0.26
119 0.31
120 0.27
121 0.27
122 0.29
123 0.29
124 0.29
125 0.28
126 0.28
127 0.24
128 0.25
129 0.24
130 0.23
131 0.24
132 0.23
133 0.22
134 0.19
135 0.18
136 0.15
137 0.11
138 0.1
139 0.08
140 0.06
141 0.07
142 0.07
143 0.06
144 0.07
145 0.06
146 0.07
147 0.06
148 0.06
149 0.06
150 0.07
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.08
157 0.08