Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YHC2

Protein Details
Accession G2YHC2    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
31-52KTNPKCRKTKCLVEKLRDRRTDBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 12.5, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MPIQHCTAPTPSNANAMLHRNAVEAFWNLEKTNPKCRKTKCLVEKLRDRRTDIVFLGVIWFYLHDQCNSRRSCMACKKNEDSSQRCDNEVTSMSVTRSAWRHNRSNHSTVAGLAWYRPTPKRDFELEDKAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.31
4 0.31
5 0.27
6 0.26
7 0.22
8 0.21
9 0.19
10 0.17
11 0.14
12 0.14
13 0.14
14 0.16
15 0.15
16 0.19
17 0.27
18 0.28
19 0.38
20 0.44
21 0.47
22 0.54
23 0.59
24 0.65
25 0.65
26 0.72
27 0.71
28 0.73
29 0.77
30 0.77
31 0.83
32 0.83
33 0.83
34 0.76
35 0.7
36 0.64
37 0.58
38 0.53
39 0.43
40 0.35
41 0.26
42 0.22
43 0.19
44 0.14
45 0.11
46 0.07
47 0.07
48 0.05
49 0.07
50 0.08
51 0.08
52 0.11
53 0.14
54 0.21
55 0.22
56 0.23
57 0.23
58 0.24
59 0.33
60 0.4
61 0.47
62 0.46
63 0.52
64 0.55
65 0.59
66 0.64
67 0.62
68 0.57
69 0.55
70 0.57
71 0.52
72 0.48
73 0.41
74 0.35
75 0.3
76 0.27
77 0.23
78 0.16
79 0.16
80 0.15
81 0.17
82 0.17
83 0.17
84 0.18
85 0.23
86 0.3
87 0.35
88 0.43
89 0.49
90 0.58
91 0.62
92 0.64
93 0.59
94 0.54
95 0.48
96 0.41
97 0.34
98 0.26
99 0.19
100 0.15
101 0.16
102 0.15
103 0.2
104 0.24
105 0.28
106 0.32
107 0.37
108 0.42
109 0.45
110 0.5
111 0.53