Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YS59

Protein Details
Accession G2YS59    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-38ASSNPKEATRRPHKKSRYGCKSCKTRRLKVRTPILSQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MASSNPKEATRRPHKKSRYGCKSCKTRRLKVRTPILSQHHHSTTTPQTPNSDSIPSAMKLNRHVRIVRGIAYNVNTYSCLSTIPRFQYFPQRSYLFPLPRQSQDGMLISRVLCHAIPFLSIFQPPLPLPSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.82
3 0.86
4 0.87
5 0.87
6 0.87
7 0.88
8 0.87
9 0.89
10 0.89
11 0.89
12 0.86
13 0.85
14 0.85
15 0.86
16 0.85
17 0.84
18 0.85
19 0.81
20 0.77
21 0.76
22 0.72
23 0.68
24 0.62
25 0.58
26 0.5
27 0.44
28 0.39
29 0.36
30 0.36
31 0.38
32 0.36
33 0.32
34 0.32
35 0.32
36 0.35
37 0.32
38 0.26
39 0.18
40 0.17
41 0.18
42 0.16
43 0.17
44 0.16
45 0.15
46 0.21
47 0.27
48 0.29
49 0.3
50 0.3
51 0.29
52 0.32
53 0.31
54 0.27
55 0.22
56 0.2
57 0.18
58 0.19
59 0.18
60 0.14
61 0.13
62 0.11
63 0.1
64 0.1
65 0.08
66 0.08
67 0.09
68 0.1
69 0.15
70 0.18
71 0.2
72 0.21
73 0.22
74 0.32
75 0.35
76 0.35
77 0.37
78 0.34
79 0.33
80 0.38
81 0.45
82 0.39
83 0.4
84 0.45
85 0.43
86 0.44
87 0.47
88 0.41
89 0.35
90 0.34
91 0.33
92 0.27
93 0.23
94 0.22
95 0.18
96 0.18
97 0.16
98 0.14
99 0.11
100 0.1
101 0.11
102 0.1
103 0.11
104 0.11
105 0.13
106 0.14
107 0.14
108 0.15
109 0.14
110 0.17
111 0.17
112 0.19