Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YI86

Protein Details
Accession G2YI86    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-68ETPMRSRRYKLFPKRTPWDTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 11.666, cyto_nucl 9.833, mito 8.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MTAQSGSQMQVHKLDNAIQKQRNSSKREWTYDFSSVYLELELELELLLETPMRSRRYKLFPKRTPWDTGQNSESVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.36
4 0.43
5 0.43
6 0.44
7 0.51
8 0.58
9 0.6
10 0.59
11 0.57
12 0.59
13 0.61
14 0.64
15 0.61
16 0.57
17 0.54
18 0.51
19 0.47
20 0.36
21 0.3
22 0.24
23 0.19
24 0.14
25 0.09
26 0.06
27 0.05
28 0.04
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.06
38 0.12
39 0.16
40 0.17
41 0.21
42 0.28
43 0.38
44 0.49
45 0.58
46 0.64
47 0.69
48 0.77
49 0.82
50 0.79
51 0.77
52 0.71
53 0.71
54 0.66
55 0.63
56 0.56