Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YPH7

Protein Details
Accession G2YPH7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-56RTEKWEQTKKIPRCPNWKHHAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 8
Family & Domain DBs
Amino Acid Sequences MACRSVAHNARKGIEISGTKSNPVIICPAHIGGFSRTEKWEQTKKIPRCPNWKHHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.28
3 0.26
4 0.3
5 0.29
6 0.27
7 0.26
8 0.27
9 0.21
10 0.2
11 0.18
12 0.1
13 0.11
14 0.12
15 0.12
16 0.1
17 0.1
18 0.11
19 0.09
20 0.14
21 0.15
22 0.16
23 0.17
24 0.19
25 0.22
26 0.28
27 0.35
28 0.35
29 0.45
30 0.54
31 0.6
32 0.68
33 0.75
34 0.76
35 0.79
36 0.84