Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y412

Protein Details
Accession G2Y412   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-46SSDRGKQRDRNNPGAPRENPHydrophilic
NLS Segment(s)
PositionSequence
255-262RRSISPRR
289-291GRG
414-441RRPPGGRPSGGRSHMRGSSPMSRRPPGG
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MNHRKDGDGISKASTTGVPVPIPMGDSSDRGKQRDRNNPGAPRENPSSRKEDALRKNDNLRKDDDQPGNPRSRPRYPDRAFRDGGQEYGSDWEGNDPVDGRRGQKGRGAPQDARNLPPPTGRRDDPTDGTSRRGIPPDEIRGRPGDPRNERSMPGIDVRGRPLDRTGHDPRAMSTETSLPGRSRPNGLPGRDGKINPATGGRLPGRAPDPRSMSNFPPSSRSNGRDPQSNPGDRRQMRPPGNGAPDRSDPRSSNRRSISPRRAPPPTGYSRQLGGDAPSRSQPPPSSRGRGPPSSGDRGTPGRGSSPLGGRGTPGRDNSPRRDLPPLSTPGGRSPGGGRSPMSGSSPMSGSSPMGGSSPMGGSSPMSRGSPGGGYSGGSSPMSGSSPMSGSSSMGGGSPMGSHSPMRGLSPVSRRPPGGRPSGGRSHMRGSSPMSRRPPGGRPSGDQIRSIIAYVRCVFSQIARRIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.21
4 0.21
5 0.19
6 0.18
7 0.19
8 0.18
9 0.2
10 0.17
11 0.16
12 0.15
13 0.18
14 0.2
15 0.28
16 0.33
17 0.34
18 0.42
19 0.45
20 0.53
21 0.62
22 0.67
23 0.68
24 0.73
25 0.78
26 0.79
27 0.8
28 0.73
29 0.69
30 0.68
31 0.67
32 0.64
33 0.6
34 0.58
35 0.51
36 0.55
37 0.55
38 0.57
39 0.59
40 0.63
41 0.65
42 0.65
43 0.73
44 0.71
45 0.73
46 0.66
47 0.62
48 0.58
49 0.56
50 0.6
51 0.57
52 0.59
53 0.59
54 0.62
55 0.64
56 0.62
57 0.64
58 0.62
59 0.63
60 0.63
61 0.64
62 0.68
63 0.66
64 0.73
65 0.73
66 0.73
67 0.66
68 0.61
69 0.6
70 0.5
71 0.46
72 0.37
73 0.29
74 0.22
75 0.22
76 0.21
77 0.13
78 0.12
79 0.12
80 0.12
81 0.12
82 0.11
83 0.1
84 0.1
85 0.15
86 0.16
87 0.17
88 0.25
89 0.27
90 0.28
91 0.32
92 0.38
93 0.42
94 0.5
95 0.54
96 0.51
97 0.56
98 0.64
99 0.61
100 0.57
101 0.56
102 0.49
103 0.43
104 0.45
105 0.41
106 0.38
107 0.42
108 0.4
109 0.38
110 0.43
111 0.47
112 0.43
113 0.44
114 0.44
115 0.39
116 0.41
117 0.39
118 0.35
119 0.33
120 0.33
121 0.3
122 0.28
123 0.33
124 0.39
125 0.43
126 0.4
127 0.39
128 0.39
129 0.39
130 0.41
131 0.41
132 0.42
133 0.42
134 0.47
135 0.52
136 0.52
137 0.51
138 0.47
139 0.43
140 0.35
141 0.31
142 0.3
143 0.26
144 0.25
145 0.27
146 0.29
147 0.26
148 0.25
149 0.25
150 0.26
151 0.24
152 0.31
153 0.35
154 0.36
155 0.37
156 0.37
157 0.35
158 0.35
159 0.34
160 0.26
161 0.21
162 0.17
163 0.16
164 0.18
165 0.18
166 0.14
167 0.16
168 0.2
169 0.2
170 0.22
171 0.22
172 0.3
173 0.34
174 0.35
175 0.38
176 0.37
177 0.4
178 0.39
179 0.38
180 0.33
181 0.3
182 0.29
183 0.23
184 0.21
185 0.19
186 0.16
187 0.2
188 0.17
189 0.15
190 0.15
191 0.17
192 0.19
193 0.22
194 0.24
195 0.25
196 0.29
197 0.3
198 0.35
199 0.35
200 0.34
201 0.38
202 0.37
203 0.32
204 0.33
205 0.31
206 0.32
207 0.33
208 0.34
209 0.33
210 0.37
211 0.39
212 0.41
213 0.41
214 0.43
215 0.45
216 0.47
217 0.43
218 0.42
219 0.49
220 0.44
221 0.46
222 0.45
223 0.47
224 0.46
225 0.47
226 0.45
227 0.42
228 0.46
229 0.44
230 0.39
231 0.34
232 0.34
233 0.35
234 0.34
235 0.31
236 0.26
237 0.31
238 0.4
239 0.39
240 0.43
241 0.42
242 0.47
243 0.52
244 0.6
245 0.64
246 0.64
247 0.67
248 0.65
249 0.66
250 0.62
251 0.58
252 0.55
253 0.51
254 0.47
255 0.43
256 0.38
257 0.35
258 0.34
259 0.31
260 0.23
261 0.19
262 0.2
263 0.18
264 0.18
265 0.18
266 0.2
267 0.19
268 0.22
269 0.24
270 0.23
271 0.28
272 0.33
273 0.37
274 0.37
275 0.45
276 0.49
277 0.48
278 0.46
279 0.46
280 0.47
281 0.47
282 0.45
283 0.37
284 0.35
285 0.34
286 0.33
287 0.27
288 0.22
289 0.17
290 0.18
291 0.19
292 0.18
293 0.19
294 0.22
295 0.21
296 0.2
297 0.2
298 0.22
299 0.24
300 0.25
301 0.24
302 0.25
303 0.32
304 0.38
305 0.43
306 0.48
307 0.47
308 0.47
309 0.52
310 0.48
311 0.44
312 0.46
313 0.44
314 0.38
315 0.37
316 0.36
317 0.32
318 0.34
319 0.3
320 0.24
321 0.22
322 0.25
323 0.25
324 0.26
325 0.23
326 0.21
327 0.22
328 0.23
329 0.23
330 0.18
331 0.17
332 0.16
333 0.16
334 0.14
335 0.13
336 0.13
337 0.11
338 0.1
339 0.1
340 0.09
341 0.08
342 0.08
343 0.07
344 0.08
345 0.08
346 0.07
347 0.07
348 0.07
349 0.08
350 0.09
351 0.11
352 0.12
353 0.12
354 0.12
355 0.12
356 0.14
357 0.14
358 0.13
359 0.13
360 0.11
361 0.11
362 0.13
363 0.13
364 0.13
365 0.11
366 0.11
367 0.1
368 0.11
369 0.11
370 0.1
371 0.1
372 0.09
373 0.1
374 0.11
375 0.12
376 0.11
377 0.11
378 0.1
379 0.1
380 0.09
381 0.09
382 0.08
383 0.07
384 0.06
385 0.06
386 0.07
387 0.08
388 0.09
389 0.09
390 0.1
391 0.14
392 0.14
393 0.15
394 0.16
395 0.18
396 0.24
397 0.33
398 0.4
399 0.43
400 0.47
401 0.48
402 0.51
403 0.56
404 0.56
405 0.57
406 0.55
407 0.54
408 0.57
409 0.63
410 0.65
411 0.61
412 0.58
413 0.55
414 0.53
415 0.5
416 0.45
417 0.43
418 0.47
419 0.48
420 0.54
421 0.55
422 0.53
423 0.56
424 0.59
425 0.61
426 0.59
427 0.62
428 0.58
429 0.56
430 0.61
431 0.66
432 0.63
433 0.55
434 0.49
435 0.43
436 0.39
437 0.35
438 0.32
439 0.24
440 0.28
441 0.28
442 0.29
443 0.25
444 0.26
445 0.26
446 0.26
447 0.35