Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YK56

Protein Details
Accession G2YK56   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-65ASKSSCTRVHARRRKCGDCTRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MLRLTGIESARAPERRNRGNSFTFASKCTTSGMYLVLNYLAMFKASKSSCTRVHARRRKCGDCTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.52
4 0.54
5 0.54
6 0.54
7 0.55
8 0.52
9 0.49
10 0.42
11 0.36
12 0.34
13 0.28
14 0.24
15 0.22
16 0.19
17 0.13
18 0.13
19 0.12
20 0.09
21 0.09
22 0.08
23 0.07
24 0.06
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.12
32 0.12
33 0.17
34 0.22
35 0.27
36 0.31
37 0.37
38 0.46
39 0.49
40 0.6
41 0.65
42 0.7
43 0.75
44 0.8
45 0.82