Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YSN3

Protein Details
Accession G2YSN3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKIPWRLSKFQKARQRKRLRAVDSVHydrophilic
76-105DKYTIFDRKEKKYRKGIHKLPKWTRLSQRLHydrophilic
NLS Segment(s)
PositionSequence
84-97KEKKYRKGIHKLPK
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTNVMSGGLLWKIPWRLSKFQKARQRKRLRAVDSVVATVDRALAAKGITTKAVERWKEEMPTEQEMLPKDKYTIFDRKEKKYRKGIHKLPKWTRLSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.15
5 0.16
6 0.18
7 0.23
8 0.28
9 0.36
10 0.44
11 0.54
12 0.59
13 0.66
14 0.74
15 0.78
16 0.83
17 0.85
18 0.89
19 0.87
20 0.88
21 0.88
22 0.83
23 0.79
24 0.71
25 0.66
26 0.56
27 0.47
28 0.37
29 0.28
30 0.22
31 0.15
32 0.11
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.06
40 0.06
41 0.06
42 0.07
43 0.07
44 0.12
45 0.18
46 0.19
47 0.2
48 0.24
49 0.25
50 0.27
51 0.27
52 0.28
53 0.26
54 0.28
55 0.26
56 0.24
57 0.24
58 0.24
59 0.27
60 0.23
61 0.19
62 0.17
63 0.18
64 0.2
65 0.24
66 0.31
67 0.31
68 0.4
69 0.46
70 0.54
71 0.63
72 0.69
73 0.71
74 0.73
75 0.79
76 0.81
77 0.85
78 0.85
79 0.86
80 0.86
81 0.89
82 0.88
83 0.88
84 0.83
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79