Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YPJ5

Protein Details
Accession G2YPJ5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-80QANNSKRVPIRKRRKVIRLISGSHydrophilic
NLS Segment(s)
PositionSequence
63-84KRVPIRKRRKVIRLISGSKVGR
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MERKAYYEETLCFSFENNTYPTPYNKPAVQISTTVNNIPRSPTCHSGNEKGTSRQVGQANNSKRVPIRKRRKVIRLISGSKVGRGIMPKGNEWPRGTEKAGYHYDVGRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.2
4 0.18
5 0.18
6 0.21
7 0.23
8 0.27
9 0.29
10 0.32
11 0.32
12 0.31
13 0.34
14 0.33
15 0.34
16 0.31
17 0.28
18 0.26
19 0.26
20 0.26
21 0.24
22 0.25
23 0.23
24 0.22
25 0.23
26 0.22
27 0.23
28 0.26
29 0.29
30 0.29
31 0.33
32 0.37
33 0.4
34 0.42
35 0.43
36 0.41
37 0.38
38 0.36
39 0.32
40 0.29
41 0.28
42 0.27
43 0.23
44 0.25
45 0.31
46 0.33
47 0.37
48 0.37
49 0.33
50 0.33
51 0.4
52 0.46
53 0.48
54 0.56
55 0.6
56 0.7
57 0.77
58 0.83
59 0.84
60 0.82
61 0.81
62 0.79
63 0.73
64 0.67
65 0.66
66 0.57
67 0.48
68 0.41
69 0.32
70 0.25
71 0.23
72 0.23
73 0.22
74 0.24
75 0.24
76 0.32
77 0.38
78 0.41
79 0.4
80 0.43
81 0.43
82 0.46
83 0.47
84 0.44
85 0.4
86 0.42
87 0.44
88 0.4
89 0.36