Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2XVT0

Protein Details
Accession G2XVT0    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-49LVVTVKPKPRKGRQTRHPLPNFLHydrophilic
NLS Segment(s)
PositionSequence
34-38KPRKG
Subcellular Location(s) plas 14, E.R. 4, mito 3, extr 3, nucl 1, pero 1, golg 1
Family & Domain DBs
Amino Acid Sequences MMCLLECWSPDGTYTYMLCTLRFAVALVVTVKPKPRKGRQTRHPLPNFLSRASLSHPNWFENEALVMDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.18
4 0.18
5 0.17
6 0.16
7 0.16
8 0.13
9 0.13
10 0.11
11 0.08
12 0.07
13 0.08
14 0.08
15 0.08
16 0.09
17 0.1
18 0.16
19 0.19
20 0.25
21 0.32
22 0.4
23 0.5
24 0.6
25 0.69
26 0.74
27 0.81
28 0.85
29 0.87
30 0.83
31 0.76
32 0.7
33 0.68
34 0.61
35 0.5
36 0.43
37 0.33
38 0.3
39 0.3
40 0.35
41 0.28
42 0.34
43 0.35
44 0.34
45 0.35
46 0.35
47 0.31
48 0.23
49 0.23